TkA01G609970 | RubberDandelionOmics

Gene overview

TkA01G609970

Reference: TK1151 Chr: Chr01 Coordinates: 153757910-153761351 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2053 bp · TkA01G609970|TK1151|cDNA

AATTGAAAAAGGGGCAAAACTGGAACATCAACGCCTCGGCTGCTTCCAGCCTTCCACCATCAAGAATCCAGAATCCTATCTCCAAACTCGTTGAGCCTTCATCCCTCTCTGTCCAAACAACACACATTCAAACTAACCAAGAACAAAGATTCACACCCTCAAATTCACGTCTGTTTTCTCTTTCCATGGGGAAGCCCTAATAATCCTTACCGTAATCTTCCATTAAACCAATAAAATGGCCTCGATATCCACTTGTTTCA...

CDS

Download CDS FASTA

867 bp · TkA01G609970|TK1151|CDS

ATGGCCTCGATATCCACTTGTTTCACGATAACACCTAAATCCCACCCAAAACCATCATCATTATTTTCACTTAGACCCTCCTGTCAGTCGCAGTACCCTTATAGGACTCGTAATGATGTTTTTCATATGAAATTACTGAGAGTTGGGAGACAGCATAGTAGTAATAGTAGAAGTCTTGTGTCGGAAATCAGGGCCAGTTTTAATGGTTCGTCGATGGAAGCAACGGCAAGGATTAGGCCAGGGAGGGTAATTGAGAGCGA...

Protein

Download Protein FASTA

288 aa · TkA01G609970|TK1151|PROTEIN

MASISTCFTITPKSHPKPSSLFSLRPSCQSQYPYRTRNDVFHMKLLRVGRQHSSNSRSLVSEIRASFNGSSMEATARIRPGRVIESDKLPADVRKRAMDAVDSCGRRVTVGDVASKAGIKLSEAQRALQALAADTNGFLEVSDEGDVLYVFPKDYRTNLAGKSLRLKVEPFFEKAKSGAEYLIRVTFGTALIASIVIVYTTIIAILTSSSDEDNRGGRRRGRSFDSGFSFYLNPADLFWYWDPYYYRRRRVRKEGAGMNF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G609970`
TK1151 ID	TkA01G609970
OH-1004 ID	LXL04_000473
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 99.306 / OH-1004 54.373 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G609970

Location Chr01:153757910-153761351 (-)

Description Similar to At5g03900: Uncharacterized protein At5g03900, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03900`	Uncharacterized protein At5g03900, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000473 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

KEGG gene cross-reference

ath:AT5G03900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.983

Rank 1 · TkA01G609970 · TK1151

Mitochondrion0.021

Rank 2 · TkA01G609970 · TK1151

Nucleus0.021

Rank 3 · TkA01G609970 · TK1151

Cytoplasm0.014

Rank 4 · TkA01G609970 · TK1151

Cell membrane0.010

Rank 5 · TkA01G609970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20923COMMD9_HN53-74 aa

PF09339HTH_IclR98-132 aa

PF20923COMMD9_HN107-159 aa

PF10151TMEM214128-180 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G609970	`PF20923`	COMMD9_HN	53	74	0.13	13.3
TkA01G609970	`PF09339`	HTH_IclR	98	132	0.0065	16.9
TkA01G609970	`PF20923`	COMMD9_HN	107	159	0.13	13.3
TkA01G609970	`PF10151`	TMEM214	128	180	0.37	9.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GW20`	Arabidopsis thaliana	sp\|Q8GW20\|Y5390_ARATH Uncharacterized protein At5g03900, chloroplastic	71.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card