TkA01G607160 | RubberDandelionOmics

Gene overview

TkA01G607160

Reference: TK1151 Chr: Chr01 Coordinates: 152981535-152984357 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2206 bp · TkA01G607160|TK1151|cDNA

TTGATTTGTTCACATGTTTCGGAGTTTTGGATAAAGAAACAAAGCCACGTTACAAATCGCATCCACAACAAGAGGTGCTTCTTTCCACGGCTCACCACCATGGATTCCGTCTTCTTCCACCACCCAGTCTTTCCACCATTCACTACCACCACCGCCACCACCACCACAAGACACACATCAACCTACGCACCTCCCAAGCCACCACCAATTTCCGCCCACAAGACACCCGCTTTCACTTGCTGGGCACTCAGGAATAGCGG...

CDS

Download CDS FASTA

1698 bp · TkA01G607160|TK1151|CDS

TTGATTTGTTCACATGTTTCGGAGTTTTGGATAAAGAAACAAAGCCACGTTACAAATCGCATCCACAACAAGAGGTGCTTCTTTCCACGGCTCACCACCATGGATTCCGTCTTCTTCCACCACCCAGTCTTTCCACCATTCACTACCACCACCGCCACCACCACCACAAGACACACATCAACCTACGCACCTCCCAAGCCACCACCAATTTCCGCCCACAAGACACCCGCTTTCACTTGCTGGGCACTCAGGAATAGCGG...

Protein

Download Protein FASTA

565 aa · TkA01G607160|TK1151|PROTEIN

LICSHVSEFWIKKQSHVTNRIHNKRCFFPRLTTMDSVFFHHPVFPPFTTTTATTTTRHTSTYAPPKPPPISAHKTPAFTCWALRNSGGSENGPISEVSASNAGELFPSPEIPEAFKTVDAEITPDTIDFFVSEAEGDPDCPSDGFSSIEDALATLRLGKFVIVVDDENGDIEGNFVLAASFATPETIGFVIRHGSGIISVGMTTDDLERLNLPLMSPENEHNSSAPSFTITVDAIDTATGVSASDRAKTILALASRSSGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G607160`
TK1151 ID	TkA01G607160
OH-1004 ID	LXL04_001437
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	65.100
Protein coverage (%)	TK1151 75.575 / OH-1004 78.388 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G607160

Location Chr01:152981535-152984357 (-)

Description Similar to RIBA1: Bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59750`	Involved in riboflavin biosynthesis.	Arabidopsis RIBA proteins: two out of three isoforms have lost their bifunctional activity in riboflavin biosynthesis.2012 · DOI: 10.3390/ijms131114086
`At5g64300`	Involved in riboflavin biosynthesis.	Deficiency in riboflavin biosynthesis affects tetrapyrrole biosynthesis in etiolated Arabidopsis tissue.2012 · DOI: 10.1007/s11103-011-9846-1 Arabidopsis RIBA proteins: two out of three isoforms have lost their bifunctional activity in riboflavin biosynthesis.2012 · DOI: 10.3390/ijms131114086

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0460600`	Involved in riboflavin biosynthesis.	No verified direct reference in this release
`Os08g0481950`	Involved in riboflavin biosynthesis.	No verified direct reference in this release
`Os02g0572400`	Involved in riboflavin biosynthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001437 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009231 riboflavin biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003935 GTP cyclohydrolase II activity Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0008686 3,4-dihydroxy-2-butanone-4-phosphate synthase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G22450

ath:AT5G59750

ath:AT5G64300

dosa:Os02g0572400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.965

Rank 1 · TkA01G607160 · TK1151

Mitochondrion0.054

Rank 2 · TkA01G607160 · TK1151

Cytoplasm0.036

Rank 3 · TkA01G607160 · TK1151

Nucleus0.030

Rank 4 · TkA01G607160 · TK1151

Peroxisome0.019

Rank 5 · TkA01G607160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00926DHBP_synthase149-341 aa

PF00925GTP_cyclohydro2351-517 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G607160	`PF00926`	DHBP_synthase	149	341	2e-67	227.1
TkA01G607160	`PF00925`	GTP_cyclohydro2	351	517	4.8e-72	241.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN89`	Arabidopsis thaliana	sp\|Q9FN89\|RIBA3_ARATH Monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic	70.700%	Swiss-Prot	High
`P47924`	Arabidopsis thaliana	sp\|P47924\|RIBA1_ARATH Bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic	66.000%	Swiss-Prot	High
`Q6L506`	Oryza sativa subsp. japonica	sp\|Q6L506\|RIBA3_ORYSJ Probable monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic	70.100%	Swiss-Prot	High
`Q6Z234`	Oryza sativa subsp. japonica	sp\|Q6Z234\|RIBA1_ORYSJ Probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic	64.100%	Swiss-Prot	High
`Q0E079`	Oryza sativa subsp. japonica	sp\|Q0E079\|RIBA2_ORYSJ Probable bifunctional riboflavin biosynthesis protein RIBA 2, chloroplastic	65.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card