TkA01G602570 | RubberDandelionOmics

Gene overview

TkA01G602570

Reference: TK1151 Chr: Chr01 Coordinates: 151832781-151835510 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1632 bp · TkA01G602570|TK1151|cDNA

GATCTTGAAAAACAATTGATCCTCCCAAAAAGCTCTCTTACTCGATTCCACCAAATGATCAATACCAAAACTTTTGATCTTTGATCAAAGATTCATCCATGGTGTCTCGTTTTCGCGGCTTCTGCTCCTTTCTAGTCCTCCTTTCCATTCTGTCATCAATCTCTTTACTCTATTGTGCTTCCTTCTACTTTCATGAACAAGAACTCGGACTGGGATCGGGACTGGGACTGAGTCATAACCGTCCAATCGATCTCCTAACC...

CDS

Download CDS FASTA

1437 bp · TkA01G602570|TK1151|CDS

ATGGTGTCTCGTTTTCGCGGCTTCTGCTCCTTTCTAGTCCTCCTTTCCATTCTGTCATCAATCTCTTTACTCTATTGTGCTTCCTTCTACTTTCATGAACAAGAACTCGGACTGGGATCGGGACTGGGACTGAGTCATAACCGTCCAATCGATCTCCTAACCTTCCCATCGGCATGGAACCCCCTCTCGTTCCCTCCAAATCCGCCTCAAAAACTCCTCAAAATTGCACTTTTCGTCAAAAAGTGGCCCGACAGGCTCCA...

Protein

Download Protein FASTA

478 aa · TkA01G602570|TK1151|PROTEIN

MVSRFRGFCSFLVLLSILSSISLLYCASFYFHEQELGLGSGLGLSHNRPIDLLTFPSAWNPLSFPPNPPQKLLKIALFVKKWPDRLHAGGLERHTLTLHLALAKRGHELHIFTASSSNFSFPNYPFENLHFHISKPTNAGYLDQALVWQQFQAQNSSRKPFDVVHTESVSLMHTRAKNVSNLAVSWHGIAYETLHSDIIQELLRTPNENQTNLLTERAVKVVNEIKFFQKYTHHVATSDHVGDVLKRIYMIPEGRVHIIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G602570`
TK1151 ID	TkA01G602570
OH-1004 ID	LXL04_000559
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G602570`
Location	Chr01:151832781-151835510 (-)
Description	Similar to MJ1607: Uncharacterized glycosyltransferase MJ1607 (Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000559` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0010125 mycothiol biosynthetic process Biological Process GO:0005886 plasma membrane Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0008375 acetylglucosaminyltransferase activity Molecular Function GO:0016757 glycosyltransferase activity Molecular Function GO:0102710 D-inositol-3-phosphate glycosyltransferase activity Molecular Function
KEGG gene cross-reference	ach:Achl_2609 cai:Caci_8224 mja:MJ_1607 nca:Noca_4050 stm:STM3714 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.593

Rank 1 · TkA01G602570 · TK1151

Endoplasmic reticulum0.197

Rank 2 · TkA01G602570 · TK1151

Cytoplasm0.080

Rank 3 · TkA01G602570 · TK1151

Lysosome / Vacuole0.068

Rank 4 · TkA01G602570 · TK1151

Extracellular0.065

Rank 5 · TkA01G602570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13439Glyco_transf_489-264 aa

PF13579Glyco_trans_4_489-262 aa

PF00534Glycos_transf_1287-431 aa

PF13692Glyco_trans_1_4291-429 aa

PF13579Glyco_trans_4_4292-311 aa

PF13524Glyco_trans_1_2327-457 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G602570	`PF13439`	Glyco_transf_4	89	264	9.3e-17	62.3
TkA01G602570	`PF13579`	Glyco_trans_4_4	89	262	1.9e-05	25.8
TkA01G602570	`PF00534`	Glycos_transf_1	287	431	2.7e-11	44.1
TkA01G602570	`PF13692`	Glyco_trans_1_4	291	429	8.8e-14	52.7
TkA01G602570	`PF13579`	Glyco_trans_4_4	292	311	1.9e-05	25.8
TkA01G602570	`PF13524`	Glyco_trans_1_2	327	457	0.00098	19.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card