TkA01G599590 | RubberDandelionOmics

Gene overview

TkA01G599590

Reference: TK1151 Chr: Chr01 Coordinates: 151010072-151013734 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1566 bp · TkA01G599590|TK1151|cDNA

ATACAATCTAAGCTGAAAGTACATCTATTAAATGCATATCCTTACATTTCGCTGGATTTTGACCCAGCCCTCACGAGAAGTTTTCAACCCTAAGATCCCGGCAAAAATCTTTCACTGCTCCAGCTTCCTCTATATCAGACGCTGAAACTTTTCCATTTTCCCCATAATAAAGTGGTCACGGCAATGAGCTCGTAAGGGACATGGTGATAAGGTTTATGATGGCCGGAAGAGACACTACATCATCGGCGATGACATGGCTT...

CDS

Download CDS FASTA

333 bp · TkA01G599590|TK1151|CDS

ATGTCAACCGTTTTGGAGGTTGTTTCTTCTAGAATCACTAAAGACATACTCATGTTAGACGACATTGCAGCCGAAAAACATTACAGGCTAATTCATATACTACTGGAAAACCTCTCTTCTTTAACGGAATCACTTATCGCCATCAAACAAACATCAAAACAACAAAAGGACACGTCATCGGTCTCTGTTAATGATCTAATCCCGTCACTTCGACTCCGGATACCGACATATATGTTGGACATGCCTTTGAAGTCGATTAC...

Protein

Download Protein FASTA

110 aa · TkA01G599590|TK1151|PROTEIN

MSTVLEVVSSRITKDILMLDDIAAEKHYRLIHILLENLSSLTESLIAIKQTSKQQKDTSSVSVNDLIPSLRLRIPTYMLDMPLKSITASWESGELAKYRYTSSEVNFLFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G599590`
TK1151 ID	TkA01G599590
OH-1004 ID	LXL04_038081
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	84.600
Protein coverage (%)	TK1151 67.273 / OH-1004 42.162 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G599590

Location Chr01:151010072-151013734 (+)

Description Similar to ZW10: Centromere/kinetochore protein zw10 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32900`	May be required for accurate chromosome segregation.	MAG2 and three MAG2-INTERACTING PROTEINs form an ER-localized complex to facilitate storage protein transport in Arabidopsis thaliana.2013 · DOI: 10.1111/tpj.12347

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038081 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007094 mitotic spindle assembly checkpoint signaling Biological Process

GO:0015031 protein transport Biological Process

GO:0032527 protein exit from endoplasmic reticulum Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005819 spindle Cellular Component

GO:1990423 RZZ complex Cellular Component

KEGG gene cross-reference

ath:AT2G32900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.298

Rank 1 · TkA01G599590 · TK1151

Cytoplasm0.292

Rank 2 · TkA01G599590 · TK1151

Nucleus0.289

Rank 3 · TkA01G599590 · TK1151

Plastid0.080

Rank 4 · TkA01G599590 · TK1151

Cell membrane0.077

Rank 5 · TkA01G599590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22766ZW10_C21-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G599590	`PF22766`	ZW10_C2	1	108	1.8e-13	51.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48626`	Arabidopsis thaliana	sp\|O48626\|ZW10_ARATH Centromere/kinetochore protein zw10 homolog	45.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card