TkA01G598960 | RubberDandelionOmics

Gene overview

TkA01G598960

Reference: TK1151 Chr: Chr01 Coordinates: 150867908-150869269 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

675 bp · TkA01G598960|TK1151|cDNA

ATGGTGACAAACGATGTGTTTTCTAACGACATCGGAGAGTGTTTAACTTGGGAAGAACTGAAAAACTACCCCAATTACGACCCGAATCATGGATTAATCAACCAAGTTGAAGTAATCAAATCTGGAAAGATCTCGAGAGGCTCTACAAAGCAATCGAAAGGTGGCAACAACTCTAAACTGTTGATCAAGGGACAATGGACAGAAGAGGAAGACAGCAAGCTAATCAGGCTGGTGAAGCAACATGGAATAACGAAATGGGC...

CDS

Download CDS FASTA

675 bp · TkA01G598960|TK1151|CDS

ATGGTGACAAACGATGTGTTTTCTAACGACATCGGAGAGTGTTTAACTTGGGAAGAACTGAAAAACTACCCCAATTACGACCCGAATCATGGATTAATCAACCAAGTTGAAGTAATCAAATCTGGAAAGATCTCGAGAGGCTCTACAAAGCAATCGAAAGGTGGCAACAACTCTAAACTGTTGATCAAGGGACAATGGACAGAAGAGGAAGACAGCAAGCTAATCAGGCTGGTGAAGCAACATGGAATAACGAAATGGGC...

Protein

Download Protein FASTA

224 aa · TkA01G598960|TK1151|PROTEIN

MVTNDVFSNDIGECLTWEELKNYPNYDPNHGLINQVEVIKSGKISRGSTKQSKGGNNSKLLIKGQWTEEEDSKLIRLVKQHGITKWAVIAEKMTGRAGKQCRERWGNHLRPDIRKDTWSEEEVRMLIDAHQKVGNKWAEIAKLIPGRTENAIKNQWNATKRRQNSSRKSKKTNAKNKKSQSSLLQDYIRRFAGNLRYGLFSASLTLHDENSNMYLNNCPEDDMP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G598960`
TK1151 ID	TkA01G598960
OH-1004 ID	LXL04_000620
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	70.100
Protein coverage (%)	TK1151 100.000 / OH-1004 77.750 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G598960

Location Chr01:150867908-150869269 (+)

Description Similar to MYB119: Transcription factor MYB119

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58850`	Transcription factor required for female gametophyte fertility.	MYB64 and MYB119 are required for cellularization and differentiation during female gametogenesis in Arabidopsis thaliana.2013 · DOI: 10.1371/journal.pgen.1003783
`At5g11050`	Transcription factor required for female gametophyte fertility.	MYB64 and MYB119 are required for cellularization and differentiation during female gametogenesis in Arabidopsis thaliana.2013 · DOI: 10.1371/journal.pgen.1003783
`At4g18770`	Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules.	MYB98 is required for pollen tube guidance and synergid cell differentiation in Arabidopsis.2005 · DOI: 10.1105/tpc.105.034603 Genome-wide expression profiling of the Arabidopsis female gametophyte identifies families of small, secreted proteins.2007 · DOI: 10.1371/journal.pgen.0030171 Cytoplasmic Ca2+ changes dynamically during the interaction of the pollen tube with synergid cells.2012 · DOI: 10.1242/dev.081208
`At3g27785`	Transcription activator that recognizes the motif 5'-TAACGG-3' in the promoter of endosperm-induced genes.	Overexpression of PGA37/MYB118 and MYB115 promotes vegetative-to-embryonic transition in Arabidopsis.2009 · DOI: 10.1038/cr.2008.276 Involvement of an R2R3-MYB transcription factor gene AtMYB118 in embryogenesis in Arabidopsis.2009 · DOI: 10.1007/s00299-008-0644-4 MYB118 represses endosperm maturation in seeds of Arabidopsis.2014 · DOI: 10.1105/tpc.114.130021 Transcriptional Activation of Two Delta-9 Palmitoyl-ACP Desaturase Genes by MYB115 and MYB118 Is Critical for Biosynthesis of Omega-7 Monounsaturated Fatty Acids in the Endosperm of Arabidopsis Seeds.2016 · DOI: 10.1105/tpc.16.00612

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0841500`	Transcription factor involved in abiotic stress responses.	Overexpression of an R1R2R3 MYB gene, OsMYB3R-2, increases tolerance to freezing, drought, and salt stress in transgenic Arabidopsis.2007 · DOI: 10.1104/pp.106.094532 Enhanced tolerance to chilling stress in OsMYB3R-2 transgenic rice is mediated by alteration in cell cycle and ectopic expression of stress genes.2009 · DOI: 10.1104/pp.108.133454

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000620 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009960 endosperm development Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0010439 regulation of glucosinolate biosynthetic process Biological Process

GO:0045691 regulation of embryo sac central cell differentiation Biological Process

GO:0045697 regulation of synergid differentiation Biological Process

GO:0045723 positive regulation of fatty acid biosynthetic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT3G27785

ath:AT4G18770

ath:AT5G11050

ath:AT5G40360

ath:AT5G58850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.912

Rank 1 · TkA01G598960 · TK1151

Cytoplasm0.179

Rank 2 · TkA01G598960 · TK1151

Cell membrane0.020

Rank 3 · TkA01G598960 · TK1151

Mitochondrion0.020

Rank 4 · TkA01G598960 · TK1151

Endoplasmic reticulum0.008

Rank 5 · TkA01G598960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23588HTH_CHD1_Hrp317-26 aa

PF29913MIC2158-173 aa

PF16282SANT_DAMP1_like59-95 aa

PF00249Myb_DNA-binding63-109 aa

PF11035SNAPC263-100 aa

PF15963Myb_DNA-bind_764-105 aa

PF26019HTH_TIMELESS64-81 aa

PF09111SLIDE65-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G598960	`PF23588`	HTH_CHD1_Hrp3	17	26	0.012	16.3
TkA01G598960	`PF29913`	MIC21	58	173	0.18	11.9
TkA01G598960	`PF16282`	SANT_DAMP1_like	59	95	3.2e-05	24.7
TkA01G598960	`PF00249`	Myb_DNA-binding	63	109	1.2e-33	115.7
TkA01G598960	`PF11035`	SNAPC2	63	100	2.0	9.2
TkA01G598960	`PF15963`	Myb_DNA-bind_7	64	105	6.6e-07	29.8
TkA01G598960	`PF26019`	HTH_TIMELESS	64	81	0.093	13.7
TkA01G598960	`PF09111`	SLIDE	65	92	0.0057	17.4
TkA01G598960	`PF23588`	HTH_CHD1_Hrp3	65	89	0.012	16.3
TkA01G598960	`PF13837`	Myb_DNA-bind_4	65	107	0.05	14.7
TkA01G598960	`PF13873`	Myb_DNA-bind_5	65	81	1.4	9.6
TkA01G598960	`PF13921`	Myb_DNA-bind_6	66	126	9.8e-27	93.6
TkA01G598960	`PF10545`	MADF_DNA_bdg	85	116	0.27	12.3
TkA01G598960	`PF16282`	SANT_DAMP1_like	108	141	3.2e-05	24.7
TkA01G598960	`PF09111`	SLIDE	111	144	0.0057	17.4
TkA01G598960	`PF15963`	Myb_DNA-bind_7	114	166	6.6e-07	29.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIM4`	Arabidopsis thaliana	sp\|Q9FIM4\|MY119_ARATH Transcription factor MYB119	63.800%	Swiss-Prot	Medium
`Q9FY60`	Arabidopsis thaliana	sp\|Q9FY60\|MYB64_ARATH Transcription factor MYB64	75.000%	Swiss-Prot	Low
`Q9S7L2`	Arabidopsis thaliana	sp\|Q9S7L2\|MYB98_ARATH Transcription factor MYB98	48.500%	Swiss-Prot	Medium
`Q9LVW4`	Arabidopsis thaliana	sp\|Q9LVW4\|MY118_ARATH Transcription factor MYB118	65.300%	Swiss-Prot	Low
`Q0JHU7`	Oryza sativa subsp. japonica	sp\|Q0JHU7\|MB3R2_ORYSJ Transcription factor MYB3R-2	65.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card