TkA01G596980 | RubberDandelionOmics

Gene overview

TkA01G596980

Reference: TK1151 Chr: Chr01 Coordinates: 150289430-150290724 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1222 bp · TkA01G596980|TK1151|cDNA

AAAATCCTAACCCCTCCAAACTCTTCAAAGAAATTTCCTTTTATATTCACTAAATTTCAAATTTACATAACTACCCTTTTCTATACATACATATATCTATATATCTTTTTGTTTATTTCTGTATATTGTCAAAATGGAATGTGAGGGGATTAAGGTAAGAAGCTACGATGGAAGTCTTGATAGATCAAGACTCGAAGTTCTTGAAAGAAGATGTGAAGTAGGCCCATCACATGTGTTCCTCTTCACTGACACCATGGGTG...

CDS

Download CDS FASTA

1089 bp · TkA01G596980|TK1151|CDS

ATGGAATGTGAGGGGATTAAGGTAAGAAGCTACGATGGAAGTCTTGATAGATCAAGACTCGAAGTTCTTGAAAGAAGATGTGAAGTAGGCCCATCACATGTGTTCCTCTTCACTGACACCATGGGTGACCCCATTTGTAGAATACGCAATAGTCCCTTGTACATCATGCTGGTGGCCGAGTGGAACCATGAGTTAGTTGGTGCCATTCAGGGTTCTATCAAAGTGGTCAGATTGAAAGATTTGGCTAAAGTGGGCTACAT...

Protein

Download Protein FASTA

363 aa · TkA01G596980|TK1151|PROTEIN

MECEGIKVRSYDGSLDRSRLEVLERRCEVGPSHVFLFTDTMGDPICRIRNSPLYIMLVAEWNHELVGAIQGSIKVVRLKDLAKVGYILGLRVSPFHRRTGIGLSLVQHLEEWFIRNQVDYAYMATEKDNNASVNLFVNKLRYVRFRTPAILVHPVKSRPLKMSSKIEIFKINEENAEYLYRRFMGLTEFFPADIDKVLGNKLSLGTWVACDSSERGQFGQNGNFPSNWAMLSVWNSGGLFKLRIGKAPVSCLLYSEVLKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G596980`
TK1151 ID	TkA01G596980
OH-1004 ID	LXL04_000645
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.200
Protein coverage (%)	TK1151 98.623 / OH-1004 79.911 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G596980

Location Chr01:150289430-150290724 (+)

Description Similar to At2g23060: Probable N-acetyltransferase HLS1-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37580`	Ethylene-responsive N-acetyltransferase required for differential cell elongation in the hypocotyl.	Involvement of HLS1 in sugar and auxin signaling in Arabidopsis leaves.2006 · DOI: 10.1093/pcp/pcl027 Coordinated regulation of apical hook development by gibberellins and ethylene in etiolated Arabidopsis seedlings.2012 · DOI: 10.1038/cr.2012.29
`At2g23060`	Probable N-acetyltransferase HLS1-like.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0650300`	Possesses intrinsic histone acetyltransferase activity and acts as a positive regulator of grain weight, hull size, yield, and plant biomass.	Regulation of the plastochron by three many-noded dwarf genes in barley.2021 · DOI: 10.1371/journal.pgen.1009292 The ubiquitin-interacting motif-type ubiquitin receptor HDR3 interacts with and stabilizes the histone acetyltransferase GW6a to control the grain size in rice.2021 · DOI: 10.1093/plcell/koab194

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000645 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009640 photomorphogenesis Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0008080 N-acetyltransferase activity Molecular Function

GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Molecular Function

KEGG gene cross-reference

ath:AT2G23060

ath:AT4G37580

osa:107275998

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.267

Rank 1 · TkA01G596980 · TK1151

Cytoplasm0.237

Rank 2 · TkA01G596980 · TK1151

Nucleus0.184

Rank 3 · TkA01G596980 · TK1151

Peroxisome0.124

Rank 4 · TkA01G596980 · TK1151

Endoplasmic reticulum0.114

Rank 5 · TkA01G596980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00583Acetyltransf_145-136 aa

PF13673Acetyltransf_1051-118 aa

PF13508Acetyltransf_755-121 aa

PF08445FR4783-136 aa

PF29660YfdS_N170-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G596980	`PF00583`	Acetyltransf_1	45	136	6.4e-14	52.9
TkA01G596980	`PF13673`	Acetyltransf_10	51	118	0.0016	19.1
TkA01G596980	`PF13508`	Acetyltransf_7	55	121	3.7e-05	24.7
TkA01G596980	`PF08445`	FR47	83	136	0.00027	21.6
TkA01G596980	`PF29660`	YfdS_N	170	187	0.0015	18.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42381`	Arabidopsis thaliana	sp\|Q42381\|HLS1_ARATH Probable N-acetyltransferase HLS1	46.700%	Swiss-Prot	Medium
`O64815`	Arabidopsis thaliana	sp\|O64815\|HLS1L_ARATH Probable N-acetyltransferase HLS1-like	45.300%	Swiss-Prot	Medium
`Q67UR2`	Oryza sativa subsp. japonica	sp\|Q67UR2\|GW6A_ORYSJ Acetyl transferase GW6a	32.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card