TkA01G596450 | RubberDandelionOmics

Gene overview

TkA01G596450

Reference: TK1151 Chr: Chr01 Coordinates: 150179445-150185313 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2241 bp · TkA01G596450|TK1151|cDNA

ATGATCCTTATTCTTGCAGTGGGGTACGATGAAGATTGGTACGAGGATACACCACGAAGTGCAAAAGCGATAGCAACCCCGAATGTCGAATCTCAAATCTCAGAACTTACAAAAGCTGTTCTTATGCTCACAAAGGAGAAAAATGCACAACCGCCACCTCTCCCTTGTGGAGTTTGCTTACAAATGGGACATCCATCAGATTTATGTCCCCAATTGCAAGGATATTTCGAAGAAGTGCAAGCTTTGGGAGGATATTCTGG...

CDS

Download CDS FASTA

2241 bp · TkA01G596450|TK1151|CDS

ATGATCCTTATTCTTGCAGTGGGGTACGATGAAGATTGGTACGAGGATACACCACGAAGTGCAAAAGCGATAGCAACCCCGAATGTCGAATCTCAAATCTCAGAACTTACAAAAGCTGTTCTTATGCTCACAAAGGAGAAAAATGCACAACCGCCACCTCTCCCTTGTGGAGTTTGCTTACAAATGGGACATCCATCAGATTTATGTCCCCAATTGCAAGGATATTTCGAAGAAGTGCAAGCTTTGGGAGGATATTCTGG...

Protein

Download Protein FASTA

746 aa · TkA01G596450|TK1151|PROTEIN

MILILAVGYDEDWYEDTPRSAKAIATPNVESQISELTKAVLMLTKEKNAQPPPLPCGVCLQMGHPSDLCPQLQGYFEEVQALGGYSGQNQWGYDQPRGNQGWNNNQNQNYQQRPPLSPQIYQPRPPLNTSHQPSSSNMTIEDIVKILATSTQIFQQETKSSIKNLEQQVSAFASSVSKLESKGKLSSQIEKNPKHTVCAITVRSGMSYDDSNMPEEKEDEIIATKKSEVNVPLHEVLKQVPRYAKFLKELCTSKKKIKGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G596450`
TK1151 ID	TkA01G596450
OH-1004 ID	LXL04_005017
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	49.400
Protein coverage (%)	TK1151 37.936 / OH-1004 43.008 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G596450

Location Chr01:150179445-150185313 (+)

Description Similar to pol: Retrovirus-related Pol polyprotein from transposon 17.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g10690`	A type II topoisomerase that negatively supercoils closed circular double-stranded DNA in an ATP-dependent manner.	Arabidopsis thaliana DNA gyrase is targeted to chloroplasts and mitochondria.2004 · DOI: 10.1073/pnas.0400836101

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0812000`	A type II topoisomerase that negatively supercoils closed circular double-stranded DNA in an ATP-dependent manner.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005017 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0075523 viral translational frameshifting Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0042575 DNA polymerase complex Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003887 DNA-directed DNA polymerase activity Molecular Function

KEGG gene cross-reference

sce:YGR109W-B

sce:YIL082W-A

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.575

Rank 1 · TkA01G596450 · TK1151

Nucleus0.333

Rank 2 · TkA01G596450 · TK1151

Cell membrane0.115

Rank 3 · TkA01G596450 · TK1151

Endoplasmic reticulum0.087

Rank 4 · TkA01G596450 · TK1151

Mitochondrion0.056

Rank 5 · TkA01G596450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00521DNA_topoisoIV139-189 aa

PF13650Asp_protease_2289-384 aa

PF13975gag-asp_proteas299-386 aa

PF13650Asp_protease_2475-509 aa

PF13975gag-asp_proteas478-510 aa

PF00521DNA_topoisoIV576-634 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G596450	`PF00521`	DNA_topoisoIV	139	189	5.4e-05	23.0
TkA01G596450	`PF13650`	Asp_protease_2	289	384	3.7e-05	25.1
TkA01G596450	`PF13975`	gag-asp_proteas	299	386	0.0061	17.8
TkA01G596450	`PF13650`	Asp_protease_2	475	509	3.7e-05	25.1
TkA01G596450	`PF13975`	gag-asp_proteas	478	510	0.0061	17.8
TkA01G596450	`PF00521`	DNA_topoisoIV	576	634	5.4e-05	23.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAF6`	Arabidopsis thaliana	sp\|Q9CAF6\|GYRA_ARATH DNA gyrase subunit A, chloroplastic/mitochondrial	66.000%	Swiss-Prot	Low
`Q7XZF7`	Oryza sativa subsp. japonica	sp\|Q7XZF7\|GYRA_ORYSJ Probable DNA gyrase subunit A, chloroplastic/mitochondrial	60.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card