TkA01G593070 | RubberDandelionOmics

Gene overview

TkA01G593070

Reference: TK1151 Chr: Chr01 Coordinates: 149294765-149297906 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2138 bp · TkA01G593070|TK1151|cDNA

AAAGAGAAGGGCACACAGAGGAACAGTTTACAATTCGCTTTAGAGAGCCGAGTAAACCATATTGATTTGGCGGCAAGCAAACAATATTGCGATAAGGGCTGTGATTTTAAACTCTTGTAAGCATGAATCACAAAATAGACGAAGGAAAGCGAATGGGTTTTTGAAATTCATCGTACTGAAACTGTAATAGTGCAAAATGTATCAAGAAACGGGCTCCAAGTATAGTAATCTTAAGAAAATAGCAAAGTCCGCATCAGGGA...

CDS

Download CDS FASTA

1644 bp · TkA01G593070|TK1151|CDS

ATGTATCAAGAAACGGGCTCCAAGTATAGTAATCTTAAGAAAATAGCAAAGTCCGCATCAGGGAAACCTATCAATTCGTCCACGGAAAAAACTAAAACCCTAGGGTTTAAGGAAAAGGGGTTTCGGGGAGATGATTGGAGAGGTCAAAGTAGAAGACCTAAAACTGATAGCGGTGCCTCCAATGTTGAAGACGAGAGATATACGAGAAAGAATGATAGCGGGAGGAATGGTAGTACGAAATCAAAGAACGACGATTTCCA...

Protein

Download Protein FASTA

547 aa · TkA01G593070|TK1151|PROTEIN

MYQETGSKYSNLKKIAKSASGKPINSSTEKTKTLGFKEKGFRGDDWRGQSRRPKTDSGASNVEDERYTRKNDSGRNGSTKSKNDDFHGHRSKRAERDRGSFHDDKSHNTDSRGRGMKSNYRGRTEGEGQTGRDYDRNKKRVYANNTTNGEAKFQKAPGAFLSKNRTFNKRESLDERKNGEHGENRNGFMRKNREEKYETSKQLHSKQTDVTEDHNFGKKNHQNKKNMTDDSVLMFDRPKRKRRLIRIEYPNDPANKRFDN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G593070`
TK1151 ID	TkA01G593070
OH-1004 ID	LXL04_000698
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G593070`
Location	Chr01:149294765-149297906 (+)
Description	Similar to engB: Probable GTP-binding protein EngB (Ruegeria sp. (strain TM1040)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000698` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005829 cytosol Cellular Component GO:0005525 GTP binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	gox:GOX1828 rde:RD1_1453 rsp:RSP_1066 sil:SPO0530 sit:TM1040_0305 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.840

Rank 1 · TkA01G593070 · TK1151

Cytoplasm0.153

Rank 2 · TkA01G593070 · TK1151

Mitochondrion0.045

Rank 3 · TkA01G593070 · TK1151

Cell membrane0.020

Rank 4 · TkA01G593070 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA01G593070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09439SRPRB16-44 aa

PF01926MMR_HSR1205-225 aa

PF00350Dynamin_N242-242 aa

PF09439SRPRB371-426 aa

PF01926MMR_HSR1372-490 aa

PF02421FeoB_N372-534 aa

PF00009GTP_EFTU372-400 aa

PF03193RsgA_GTPase373-425 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G593070	`PF09439`	SRPRB	16	44	0.0087	16.2
TkA01G593070	`PF01926`	MMR_HSR1	205	225	2.2e-20	73.6
TkA01G593070	`PF00350`	Dynamin_N	242	242	0.00094	20.0
TkA01G593070	`PF09439`	SRPRB	371	426	0.0087	16.2
TkA01G593070	`PF01926`	MMR_HSR1	372	490	2.2e-20	73.6
TkA01G593070	`PF02421`	FeoB_N	372	534	5.3e-06	26.7
TkA01G593070	`PF00009`	GTP_EFTU	372	400	6.1e-06	26.7
TkA01G593070	`PF03193`	RsgA_GTPase	373	425	6.2e-09	36.6
TkA01G593070	`PF00350`	Dynamin_N	373	393	0.00094	20.0
TkA01G593070	`PF00350`	Dynamin_N	414	490	0.00094	20.0
TkA01G593070	`PF00009`	GTP_EFTU	445	539	6.1e-06	26.7
TkA01G593070	`PF03193`	RsgA_GTPase	476	540	6.2e-09	36.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card