Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1650 bp · TkA01G590250|TK1151|cDNA
AATATACTATATTAAAATTTTTGAGCTTAGTAAAAGTAAAAATGGAATGAACACATTGGCTATTTTATCAACTCCAAATTCAAAGACCAGGGTTTCTACAAAGTACAAGGTTTCTTTTTTCTTCTTGGTCCCCGAGTGCTTCCACTTCGAAGAAGAAAACCTTGTACAAATCCTTTTATTCTTCCTTTGAACCAGCTAAACCAATATTGATAAAAATGGCGACCCTTGTCCCTCCTCCACCTGCGGCGGCGGCGGCGGCA...
930 bp · TkA01G590250|TK1151|CDS
ATGGCGACCCTTGTCCCTCCTCCACCTGCGGCGGCGGCGGCGGCAGAAGCGATCAAGCCGGAGAAAGTCGATTACATGGACCTACCATGCCCTATTCCTTACGAAGAAATCCACCGGGAAGCCCTCATGTCCTTAAAAGCAGATTACTTTGAGGGTATGCGTATTGATTTCACTAAGGGACTCAATCAGAGGTTCTCATTGAGTCACAGTATCGCCATGGGACCCACAGAGTTCCCTTCTCAATCTGCTGACATAATCAA...
Protein
Download Protein FASTA309 aa · TkA01G590250|TK1151|PROTEIN
MATLVPPPPAAAAAAEAIKPEKVDYMDLPCPIPYEEIHREALMSLKADYFEGMRIDFTKGLNQRFSLSHSIAMGPTEFPSQSADIIKVPIANYEFGANFIDPKMMLIGRVLTDGRVNARVKCDLTENLSMKANAQLTNEPHMSHGMVNFDYKGTDYRTQFQLGNGGLLGASYIQSVTPHLSLGGEVFWAGQHRKSGLGYAARYNTDKMVASGQIASTGMVALGYVQKVSEKVSLASDLMYNYMSRDVTASFGYDYILRQC...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G590250 |
|---|---|
| TK1151 ID | TkA01G590250 |
| OH-1004 ID | LXL04_000749 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G590250 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:148513841-148517337 (+) | |||||||||
| Description | Similar to TOM40-1: Mitochondrial import receptor subunit TOM40-1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006626 protein targeting to mitochondrion Biological Process GO:0006811 monoatomic ion transport Biological Process GO:0016036 cellular response to phosphate starvation Biological Process GO:0030150 protein import into mitochondrial matrix Biological Process GO:0051204 protein insertion into mitochondrial membrane Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005741 mitochondrial outer membrane Cellular Component GO:0005742 mitochondrial outer membrane translocase complex Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G50400 ath:AT3G20000 mmu:53333 xla:380301 xtr:394730 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01459Porin_330-302 aaPF19231DUF5884108-164 aaPF12519MDM10172-254 aaPF19231DUF5884197-249 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G590250 | PF01459 | Porin_3 | 30 | 302 | 5.5e-64 | 216.9 |
| TkA01G590250 | PF19231 | DUF5884 | 108 | 164 | 0.29 | 12.0 |
| TkA01G590250 | PF12519 | MDM10 | 172 | 254 | 0.0078 | 15.9 |
| TkA01G590250 | PF19231 | DUF5884 | 197 | 249 | 0.29 | 12.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.