TkA01G590000 | RubberDandelionOmics

Gene overview

TkA01G590000

Reference: TK1151 Chr: Chr01 Coordinates: 148430581-148433522 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2508 bp · TkA01G590000|TK1151|cDNA

ATGGCTGAAGATGAAGGTTTTCCAAGGGTGGACTTATACTATTACGGCGTTTTTATTCCGAATCCATTGGTGTACTTTAACTATGAGATGAAATCGATTAGGGATCTTGATTTCAAAGCCATGAGTTGGTCCGATTTCAAGCACTTGATAGGAAGGCTCGCAGACTCGTCCTTGTCCACTGAACGCATCTACTTTTGCCCTGCTCAAGAAAGCTTTTTGAATGGATTACATGCACTTCAAAATGACTGTGACTTCAATGC...

CDS

Download CDS FASTA

2508 bp · TkA01G590000|TK1151|CDS

ATGGCTGAAGATGAAGGTTTTCCAAGGGTGGACTTATACTATTACGGCGTTTTTATTCCGAATCCATTGGTGTACTTTAACTATGAGATGAAATCGATTAGGGATCTTGATTTCAAAGCCATGAGTTGGTCCGATTTCAAGCACTTGATAGGAAGGCTCGCAGACTCGTCCTTGTCCACTGAACGCATCTACTTTTGCCCTGCTCAAGAAAGCTTTTTGAATGGATTACATGCACTTCAAAATGACTGTGACTTCAATGC...

Protein

Download Protein FASTA

835 aa · TkA01G590000|TK1151|PROTEIN

MAEDEGFPRVDLYYYGVFIPNPLVYFNYEMKSIRDLDFKAMSWSDFKHLIGRLADSSLSTERIYFCPAQESFLNGLHALQNDCDFNAFIEATYEGKQLVNLYIDHLDEPLFEWLEKEDPESANEAVEMNDEEDVDSQLYDNEKWEHEEDEEVVSIKRTTNDHFLNKLCPIQFEVEEDEGPQRPVFPVHDATKDWKEMTPVIGMKFANPSVLEFFLSNYAVANGYDLYYEKNDKDRLLVKCCKNRIPSCPFRLWASWMKNE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G590000`
TK1151 ID	TkA01G590000
OH-1004 ID	LXL04_025894
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	46.500
Protein coverage (%)	TK1151 99.281 / OH-1004 74.283 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G590000`
Location	Chr01:148430581-148433522 (+)
Description	Similar to At5g37930: E3 ubiquitin-protein ligase SINA-like 10
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025894` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009411 response to UV Biological Process GO:0016567 protein ubiquitination Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function
KEGG gene cross-reference	ath:AT1G66620 ath:AT5G37870 ath:AT5G37890 ath:AT5G37910 ath:AT5G37930 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · TkA01G590000 · TK1151

Cytoplasm0.081

Rank 2 · TkA01G590000 · TK1151

Cell membrane0.022

Rank 3 · TkA01G590000 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA01G590000 · TK1151

Mitochondrion0.010

Rank 5 · TkA01G590000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26130PB1-like12-105 aa

PF03108DBD_Tnp_Mut198-265 aa

PF04434SWIM325-328 aa

PF10551MULE397-473 aa

PF04434SWIM572-599 aa

PF13696zf-CCHC_2686-702 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G590000	`PF26130`	PB1-like	12	105	0.00047	21.1
TkA01G590000	`PF03108`	DBD_Tnp_Mut	198	265	2.2e-07	31.1
TkA01G590000	`PF04434`	SWIM	325	328	3.8e-05	23.8
TkA01G590000	`PF10551`	MULE	397	473	1.8e-09	38.6
TkA01G590000	`PF04434`	SWIM	572	599	3.8e-05	23.8
TkA01G590000	`PF13696`	zf-CCHC_2	686	702	0.28	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card