TkA01G589540 | RubberDandelionOmics

Gene overview

TkA01G589540

Reference: TK1151 Chr: Chr01 Coordinates: 148314853-148319034 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

738 bp · TkA01G589540|TK1151|cDNA

ATGGAAGGTCTTATGAACAGTTTTTTTTACGAACTTGCAATCTGCTACACGATTTCTGTCCGCCATCCGTTCTTCATCGCAATCACCGTATATCTTGGAAGATGTTTTAGGGGCCAGGGTTTGCTGCGATTGGGTGTTCCAAAGCTGCGGAGATGTTCATATTATCAAAACTCAGTTGCAGTTTGGGTTGCCGATACTTTGCTTATTGAACAACATGGGGATAGTATCTTAAAAGACAGAGCAGTGAGTCCAAGAATATC...

CDS

Download CDS FASTA

738 bp · TkA01G589540|TK1151|CDS

ATGGAAGGTCTTATGAACAGTTTTTTTTACGAACTTGCAATCTGCTACACGATTTCTGTCCGCCATCCGTTCTTCATCGCAATCACCGTATATCTTGGAAGATGTTTTAGGGGCCAGGGTTTGCTGCGATTGGGTGTTCCAAAGCTGCGGAGATGTTCATATTATCAAAACTCAGTTGCAGTTTGGGTTGCCGATACTTTGCTTATTGAACAACATGGGGATAGTATCTTAAAAGACAGAGCAGTGAGTCCAAGAATATC...

Protein

Download Protein FASTA

245 aa · TkA01G589540|TK1151|PROTEIN

MEGLMNSFFYELAICYTISVRHPFFIAITVYLGRCFRGQGLLRLGVPKLRRCSYYQNSVAVWVADTLLIEQHGDSILKDRAVSPRISTISSDDDTKDIKNIYVDNEAFQVGDEVEIVGSEGMHKFSLYRAQIVGMHGELVEVEYYNRLTFGGERLSEFVLPTKVRSIPDAVVGDFKPTDFVDAWLEGGWWGGIVLGGNEQSAIVFFPYKPTGKQHLILPKSQLRIHQKWTRAQPYEMWLYRKRFT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G589540`
TK1151 ID	TkA01G589540
OH-1004 ID	LXL04_011372
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	63.500
Protein coverage (%)	TK1151 99.184 / OH-1004 82.916 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G589540`
Location	Chr01:148314853-148319034 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011372` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process GO:0007019 microtubule depolymerization Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0051013 microtubule severing Biological Process GO:0051510 regulation of unidimensional cell growth Biological Process GO:0000775 chromosome, centromeric region Cellular Component GO:0000792 heterochromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005874 microtubule Cellular Component GO:0008352 katanin complex Cellular Component
KEGG gene cross-reference	ath:AT1G09320 ath:AT1G61210 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.486

Rank 1 · TkA01G589540 · TK1151

Cytoplasm0.386

Rank 2 · TkA01G589540 · TK1151

Endoplasmic reticulum0.093

Rank 3 · TkA01G589540 · TK1151

Cell membrane0.090

Rank 4 · TkA01G589540 · TK1151

Mitochondrion0.055

Rank 5 · TkA01G589540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05641Agenet111-168 aa

PF05641Agenet186-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G589540	`PF05641`	Agenet	111	168	3.7e-05	24.8
TkA01G589540	`PF05641`	Agenet	186	226	3.7e-05	24.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card