TkA01G589530 | RubberDandelionOmics

Gene overview

TkA01G589530

Reference: TK1151 Chr: Chr01 Coordinates: 148308654-148311771 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1936 bp · TkA01G589530|TK1151|cDNA

TTAAAGCAAACGAACGTTCAAGCACCCAAAAATGAAGATGGTAGTTGGGGGACTTTTATGGTAATGTGATCATAATGCAAATATGAAGACGGTGTTTTACGGAACCTTTATCGTGATGTTCTCAATGCTGGATGCCCTTAAAAATCACGTCACAATTTTCTCTAAATTAGCATGGAGTTTGTGAACGATGATCAAACCATAACGTACACGATTCTTCGCTAATCGATCTCCAATTCTTGATCAATTTACTTAACCCCATT...

CDS

Download CDS FASTA

1299 bp · TkA01G589530|TK1151|CDS

ATGGAATTCAACACCATTAAAATCAATTCAACCTTCACTTCGCCATTTGAGAGCTCTCCTAGAGCAGATGATGATAACTCGCCGTTCAGAAAACCACTTAGTTTATGGCCAGGTATGTACCATTCTCCTGTCACAGCTGCTTTGTGGGAAACTAGAACCAAAATCTTTGAGAGACTTCTTGATCCACCAAAAGACGCACCTCCACAAAGTGAATTGCTCACAAAAACCCCATCTCAAAGCAGGACAACCATTCTCTACAA...

Protein

Download Protein FASTA

432 aa · TkA01G589530|TK1151|PROTEIN

MEFNTIKINSTFTSPFESSPRADDDNSPFRKPLSLWPGMYHSPVTAALWETRTKIFERLLDPPKDAPPQSELLTKTPSQSRTTILYNFSTDYILREQYRDPWNEVRIGKLLEDLDALAGTISVKHCSDEDSMTRPLLLVTASVDKMVLKKTISVDGDLKMAGSVIWVGRSSIEVQLEVTQLSTDSTVITETVALSANFIFVARDSKTGKAAPVNRLQPQTEIEKSLYKEADERNVIRKSKKGEKKGIGNGDEHRIDSFLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G589530`
TK1151 ID	TkA01G589530
OH-1004 ID	LXL04_000765
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G589530`
Location	Chr01:148308654-148311771 (+)
Description	Similar to Acot9: Acyl-coenzyme A thioesterase 9, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000765` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001676 long-chain fatty acid metabolic process Biological Process GO:0006637 acyl-CoA metabolic process Biological Process GO:0046459 short-chain fatty acid metabolic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0009507 chloroplast Cellular Component GO:0003986 acetyl-CoA hydrolase activity Molecular Function GO:0047617 fatty acyl-CoA hydrolase activity Molecular Function GO:0052689 carboxylic ester hydrolase activity Molecular Function GO:0052816 long-chain fatty acyl-CoA hydrolase activity Molecular Function
KEGG gene cross-reference	hsa:23597 mmu:56360 mmu:64833 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.317

Rank 1 · TkA01G589530 · TK1151

Plastid0.276

Rank 2 · TkA01G589530 · TK1151

Peroxisome0.200

Rank 3 · TkA01G589530 · TK1151

Cytoplasm0.187

Rank 4 · TkA01G589530 · TK1151

Nucleus0.103

Rank 5 · TkA01G589530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF030614HBT118-181 aa

PF030614HBT298-354 aa

PF01575MaoC_dehydratas301-350 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G589530	`PF03061`	4HBT	118	181	1.6e-07	32.2
TkA01G589530	`PF03061`	4HBT	298	354	1.6e-07	32.2
TkA01G589530	`PF01575`	MaoC_dehydratas	301	350	0.12	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card