Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1226 bp · TkA01G588390|TK1151|cDNA
AAAAACACAGTTAGTGGGACTACGGAACAGGGTCGACTCGAGAATCAAGTCTTCAAACAAGTCAAAAAGAAAAGAGGGAACCGAACCCTACTTACTTACATTCCCGCCTTTACGGTGAATCAAACAGGAGCCGGAGGACGACGAAGCGTACCGCTGCGTTACTACACTCATACAAATATTGAATCATGTGTGGCCGTTGCCGTTGTTCTATCCGTCCAGATGATATCCCCCGCCATAGCAACCTCGGTAACCGCCCCGTC...
996 bp · TkA01G588390|TK1151|CDS
ATGTGTGGCCGTTGCCGTTGTTCTATCCGTCCAGATGATATCCCCCGCCATAGCAACCTCGGTAACCGCCCCGTCCGTTTCGTCGATACAGACCGGTATCGTCCAGCATACAATGTTTCCCCTGGATCAAACTTGCCTGTTGTTCGAAGAGACACTGGAGCAAATGGCGAAGGCGCTGTTGTGCAGTGCATGAAATGGGGACTCATTCCAAGCTTTACAAAGAGCACTGAAAAACCAGACTATTACAGGATGTTCAATGC...
Protein
Download Protein FASTA331 aa · TkA01G588390|TK1151|PROTEIN
MCGRCRCSIRPDDIPRHSNLGNRPVRFVDTDRYRPAYNVSPGSNLPVVRRDTGANGEGAVVQCMKWGLIPSFTKSTEKPDYYRMFNARSESIGEKASFRRLLPGNRCLVVVEGFYEWKKDGGKKQPYYIHLKDDRPFVFAGLYDSWKNSEGEIQYTFTILTTSSSSTLSWLHDRMPVILGNKVSIDEWLDATPSSKFDSLLKPYEEADLVWYPVTSAMGKPSFDGPECIKEIQVKETKPISMFFAKMENKKTEKPKEEAE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G588390 |
|---|---|
| TK1151 ID | TkA01G588390 |
| OH-1004 ID | LXL04_000784 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 98.489 / OH-1004 99.694Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G588390 |
|---|---|
| Location | Chr01:148022217-148025318 (-) |
| Description | Similar to hmces: Abasic site processing protein HMCES |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006508 proteolysis Biological Process GO:0006974 DNA damage response Biological Process GO:0009432 SOS response Biological Process GO:0036297 interstrand cross-link repair Biological Process GO:0097681 double-strand break repair via alternative nonhomologous end joining Biological Process GO:0106300 protein-DNA covalent cross-linking repair Biological Process GO:0005657 replication fork Cellular Component GO:0003697 single-stranded DNA binding Molecular Function GO:0008233 peptidase activity Molecular Function GO:0016829 lyase activity Molecular Function GO:0140431 DNA-(abasic site) binding Molecular Function GO:0160129 protein-DNA covalent cross-linking activity Molecular Function |
| KEGG gene cross-reference | bsu:BSU18880 bsu:BSU20490 vg:1261483 xla:432224 xtr:394754 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02586SRAP1-220 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G588390 | PF02586 | SRAP | 1 | 220 | 1.1e-70 | 238.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.