TkA01G588360 | RubberDandelionOmics

Gene overview

TkA01G588360

Reference: TK1151 Chr: Chr01 Coordinates: 148014244-148018023 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3156 bp · TkA01G588360|TK1151|cDNA

TCTATTATATGGATCTCTTACGTCAAATCAACATTTGTCTCATCTGTATTTAATTGATTTTTAAAAAAATTCTATATTTATTTTACCAAGTACACTCCACTCATCGTTACTTAATACTATTCATGTTCCAAAACTATCTGTTTTGGTATCAGCTAGTCGACCATCCAATCATTGATCCAATGACAAATCGTGTTCTTGTAATAGGTGTTTGAAGTGGTCCACTTATGCCTTGTAGAGTCGTCTTTAAACTTCATAGCTTC...

CDS

Download CDS FASTA

1914 bp · TkA01G588360|TK1151|CDS

ATGTCATTTGATCACCAACCGCTCGATGAAATGCCAGCGCAAACCCAAACGCCAACTCCAACGCCAGTACTTTTTTCAAAGTACTCCAACAGGGTGCTGTTGAAAACTATACTAGATCGTACAGACGGTGGTTTAGGGTTGCTTGATCAGAGAGTTGTGGTCGGCGGATGGGTTAAATCTTCACGAGAAATGAGAAAAGACGCTCCTCCGACCACCCACCCTCCGGCGGCAGTGGGTGGTGATCAAACCAAGGATCATAC...

Protein

Download Protein FASTA

637 aa · TkA01G588360|TK1151|PROTEIN

MSFDHQPLDEMPAQTQTPTPTPVLFSKYSNRVLLKTILDRTDGGLGLLDQRVVVGGWVKSSREMRKDAPPTTHPPAAVGGDQTKDHTGGKDVKCVEVFQSRIPFLRTIIKVFGGNTNTAHTKEKLESVFPKPPTPSISYLQISDGSSVISLQIMVDSSIAPPPLLMPTGTCILAEGVLQKPSLQGKHTIELKADKLLHIGIVDQDSYPLSKKRLPLARLRDCAHFRPRTTTVASVMRVRNALNHCTHTFFQNQSFVHVEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G588360`
TK1151 ID	TkA01G588360
OH-1004 ID	LXL04_013571
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	38.000
Protein coverage (%)	TK1151 95.604 / OH-1004 95.936 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G588360

Location Chr01:148014244-148018023 (-)

Description Similar to SYNC1: Asparagine--tRNA ligase, cytoplasmic 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07420`	Asparagine--tRNA ligase, cytoplasmic 2.	No verified direct reference in this release
`At5g56680`	Asparagine--tRNA ligase, cytoplasmic 1.	No verified direct reference in this release
`At1g70980`	Asparagine--tRNA ligase, cytoplasmic 3.	No verified direct reference in this release
`At4g17300`	Asparagine--tRNA ligase, chloroplastic/mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013571 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006421 asparaginyl-tRNA aminoacylation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0048481 plant ovule development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003676 nucleic acid binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0004816 asparagine-tRNA ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G70980

ath:AT3G07420

ath:AT4G17300

ath:AT5G56680

sfu:Sfum_2475

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.420

Rank 1 · TkA01G588360 · TK1151

Cytoplasm0.378

Rank 2 · TkA01G588360 · TK1151

Nucleus0.159

Rank 3 · TkA01G588360 · TK1151

Peroxisome0.078

Rank 4 · TkA01G588360 · TK1151

Plastid0.039

Rank 5 · TkA01G588360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00152tRNA-synt_2227-274 aa

PF23991DUF7310302-351 aa

PF00458WHEP-TRS308-336 aa

PF00152tRNA-synt_2362-631 aa

PF00601Flu_NS2452-495 aa

PF23991DUF7310566-581 aa

PF00458WHEP-TRS572-589 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G588360	`PF00152`	tRNA-synt_2	227	274	1.2e-39	137.0
TkA01G588360	`PF23991`	DUF7310	302	351	0.21	12.8
TkA01G588360	`PF00458`	WHEP-TRS	308	336	5.8	7.7
TkA01G588360	`PF00152`	tRNA-synt_2	362	631	1.2e-39	137.0
TkA01G588360	`PF00601`	Flu_NS2	452	495	0.18	12.9
TkA01G588360	`PF23991`	DUF7310	566	581	0.21	12.8
TkA01G588360	`PF00458`	WHEP-TRS	572	589	5.8	7.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SW95`	Arabidopsis thaliana	sp\|Q9SW95\|SYNC2_ARATH Asparagine--tRNA ligase, cytoplasmic 2	48.200%	Swiss-Prot	Medium
`Q9SW96`	Arabidopsis thaliana	sp\|Q9SW96\|SYNC1_ARATH Asparagine--tRNA ligase, cytoplasmic 1	39.900%	Swiss-Prot	Medium
`Q9SSK1`	Arabidopsis thaliana	sp\|Q9SSK1\|SYNC3_ARATH Asparagine--tRNA ligase, cytoplasmic 3	39.700%	Swiss-Prot	Medium
`O48593`	Arabidopsis thaliana	sp\|O48593\|SYNO_ARATH Asparagine--tRNA ligase, chloroplastic/mitochondrial	38.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card