TkA01G581910 | RubberDandelionOmics

Gene overview

TkA01G581910

Reference: TK1151 Chr: Chr01 Coordinates: 146436992-146440501 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1843 bp · TkA01G581910|TK1151|cDNA

CTTGACTTTAAAGCCTATAAAAGCAATAATTTAGAGCTACAATCTATCCATAAGCCATTACACCATATTATAACCTCTCCAACAAGATTGACCTATAATTTGGAGAACCTGGTGATTTCAGAAGTTGTGAAAATGGCCGAAGTAGCGGTGAACCTGCGACAGCCTCTGTTGGATACTGACGTGGAAGACGTGGCTGAAGACGGATTGCAATTACGGAAACCACGACAACAACACTCCGAGGCTATTGCTCATGGCCGGAC...

CDS

Download CDS FASTA

1701 bp · TkA01G581910|TK1151|CDS

CTTGACTTTAAAGCCTATAAAAGCAATAATTTAGAGCTACAATCTATCCATAAGCCATTACACCATATTATAACCTCTCCAACAAGATTGACCTATAATTTGGAGAACCTGGTGATTTCAGAAGTTGTGAAAATGGCCGAAGTAGCGGTGAACCTGCGACAGCCTCTGTTGGATACTGACGTGGAAGACGTGGCTGAAGACGGATTGCAATTACGGAAACCACGACAACAACACTCCGAGGCTATTGCTCATGGCCGGAC...

Protein

Download Protein FASTA

566 aa · TkA01G581910|TK1151|PROTEIN

LDFKAYKSNNLELQSIHKPLHHIITSPTRLTYNLENLVISEVVKMAEVAVNLRQPLLDTDVEDVAEDGLQLRKPRQQHSEAIAHGRTKADYVDEEQTENSVYLDENGGAVEDLGLDMQKIVNAIQHHAISNEKPEAAIANRDETGRGSESIEEEEVVEEEVVEVEFQNAIPKLHTHTMHCPNCDSHITKVVLRRKIIKQRPAPQITEVPPEPVDLLGCLSCFSLFTSAGNGSFNPFPLWRTTPTSATGVQPAGNEVEVPD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G581910`
TK1151 ID	TkA01G581910
OH-1004 ID	LXL04_000825
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 98.946 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G581910

Location Chr01:146436992-146440501 (+)

Description Similar to MEB2: Membrane protein of ER body 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27870`	Not essential for the accumulation of ER body components, including PYK10.	No verified direct reference in this release
`At5g24290`	May sequester excess cytosolic iron and manganese into endoplasmic reticulum to reduce metal ion toxicity.	Identification of two novel endoplasmic reticulum body-specific integral membrane proteins.2013 · DOI: 10.1104/pp.112.207654
`At4g27860`	May sequester excess cytosolic iron and manganese into endoplasmic reticulum to reduce metal ion toxicity.	Identification of two novel endoplasmic reticulum body-specific integral membrane proteins.2013 · DOI: 10.1104/pp.112.207654

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000825 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009753 response to jasmonic acid Biological Process

GO:0010039 response to iron ion Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0010168 ER body Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT4G27860

ath:AT4G27870

ath:AT5G24290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.557

Rank 1 · TkA01G581910 · TK1151

Endoplasmic reticulum0.226

Rank 2 · TkA01G581910 · TK1151

Lysosome / Vacuole0.146

Rank 3 · TkA01G581910 · TK1151

Cytoplasm0.102

Rank 4 · TkA01G581910 · TK1151

Golgi apparatus0.076

Rank 5 · TkA01G581910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26788DUF8260173-191 aa

PF00403HMA176-198 aa

PF09600Cyd_oper_YbgE444-457 aa

PF09600Cyd_oper_YbgE480-535 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G581910	`PF26788`	DUF8260	173	191	0.085	13.6
TkA01G581910	`PF00403`	HMA	176	198	0.056	14.5
TkA01G581910	`PF09600`	Cyd_oper_YbgE	444	457	0.59	11.3
TkA01G581910	`PF09600`	Cyd_oper_YbgE	480	535	0.59	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPT3`	Arabidopsis thaliana	sp\|Q8LPT3\|MEBL_ARATH Membrane protein of ER body-like protein	41.600%	Swiss-Prot	Low
`F4KFS7`	Arabidopsis thaliana	sp\|F4KFS7\|MEB2_ARATH Membrane protein of ER body 2	39.200%	Swiss-Prot	Low
`Q8W4P8`	Arabidopsis thaliana	sp\|Q8W4P8\|MEB1_ARATH Membrane protein of ER body 1	40.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card