TkA01G581400 | RubberDandelionOmics

Gene overview

TkA01G581400

Reference: TK1151 Chr: Chr01 Coordinates: 146293103-146297713 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2572 bp · TkA01G581400|TK1151|cDNA

GTTAGTATTCCCCAAATTGAAGGCTAATAAAGAAGACAACCCTCCAAACTCCAAATATTTCGTTTTGTTTACATATAAAACTCTTAGCTTTACAGCGAGAGAGTATTCACAAAGCAAACTCATTTCAAGTTTCTCATACCCAACTAATTACTCACTGTTCTTGTTGATTCCCATCATCATTTTCACCAAGAAATTTTGTGTTTCGTGGATTCGATCACACACGTATATAAAGATTATTCCGTTCGTGATTGATTCCTTCG...

CDS

Download CDS FASTA

1722 bp · TkA01G581400|TK1151|CDS

ATGCCAGCCTTGATTCATGAAGATACGAGCACTCATTTGGGGACAAGTGGGGATGATAAGAAAAGAGTTAGGGCTAGATCTTTGAAGAAGAAAGCAATGGTTGCATCAACAAGACCGATAAACTCAATCAAAACAAGAAGTAATAAGCGCGTATCAAATTGCAAGTTTGCTTCAATTTCAATCGATGATGTTAGAGATGAAGAGGAAGAGAAGGTAGTGAATGCTTTTCGCCAAATCTTGATTGAAAAAGACTTACTTCC...

Protein

Download Protein FASTA

573 aa · TkA01G581400|TK1151|PROTEIN

MPALIHEDTSTHLGTSGDDKKRVRARSLKKKAMVASTRPINSIKTRSNKRVSNCKFASISIDDVRDEEEEKVVNAFRQILIEKDLLPHRHDDYHTLLRFLKARKFDIDKAVQMWTDMLNWRKDYGADSILKDFVYNEYEEVQSYYPHGYHGVDKEGRPIYIERLGKVDPTKLMNVTTVDRFLRYHVQGFEKAFFEKFPACSVAARRHIDSCTTILDVHGMNWMSFGKVAHDLVMRMQRIDGDNYPETLHQMYIVNAGNGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G581400`
TK1151 ID	TkA01G581400
OH-1004 ID	LXL04_000836
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 95.025 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G581400

Location Chr01:146293103-146297713 (+)

Description Similar to SFH9: Phosphatidylinositol/phosphatidylcholine transfer protein SFH9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24840`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At4g39170`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At2g21520`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At1g75370`	Required for transport of secretory proteins from the Golgi complex.	No verified direct reference in this release
`At4g39180`	Required for transport of secretory proteins from the Golgi complex (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000836 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006656 phosphatidylcholine biosynthetic process Biological Process

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0015031 protein transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008526 phosphatidylinositol transfer activity Molecular Function

KEGG gene cross-reference

ath:AT2G18180

ath:AT3G24840

ath:AT4G39170

ath:AT4G39180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.200

Rank 1 · TkA01G581400 · TK1151

Cell membrane0.191

Rank 2 · TkA01G581400 · TK1151

Plastid0.189

Rank 3 · TkA01G581400 · TK1151

Cytoplasm0.173

Rank 4 · TkA01G581400 · TK1151

Golgi apparatus0.148

Rank 5 · TkA01G581400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28528UBA_Pinta67-113 aa

PF03765CRAL_TRIO_N86-116 aa

PF00650CRAL_TRIO144-305 aa

PF13716CRAL_TRIO_2211-308 aa

PF12725DUF3810421-541 aa

PF29075NOCA1_mid477-544 aa

PF24362DUF7518486-545 aa

PF28528UBA_Pinta497-531 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G581400	`PF28528`	UBA_Pinta	67	113	6.2e-05	23.9
TkA01G581400	`PF03765`	CRAL_TRIO_N	86	116	1.4e-08	35.4
TkA01G581400	`PF00650`	CRAL_TRIO	144	305	4.3e-32	111.8
TkA01G581400	`PF13716`	CRAL_TRIO_2	211	308	0.0022	19.1
TkA01G581400	`PF12725`	DUF3810	421	541	0.081	13.0
TkA01G581400	`PF29075`	NOCA1_mid	477	544	0.013	16.1
TkA01G581400	`PF24362`	DUF7518	486	545	0.11	13.9
TkA01G581400	`PF28528`	UBA_Pinta	497	531	6.2e-05	23.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4J7S8`	Arabidopsis thaliana	sp\|F4J7S8\|SFH9_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH9	52.200%	Swiss-Prot	High
`F4JVA6`	Arabidopsis thaliana	sp\|F4JVA6\|SFH6_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH6	44.800%	Swiss-Prot	Medium
`F4IHJ0`	Arabidopsis thaliana	sp\|F4IHJ0\|SFH8_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH8	42.900%	Swiss-Prot	Medium
`Q8GXC6`	Arabidopsis thaliana	sp\|Q8GXC6\|SFH5_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH5	42.100%	Swiss-Prot	Medium
`F4JVA9`	Arabidopsis thaliana	sp\|F4JVA9\|SFH2_ARATH Phosphatidylinositol/phosphatidylcholine transfer protein SFH2	60.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card