TkA01G578800 | RubberDandelionOmics

Gene overview

TkA01G578800

Reference: TK1151 Chr: Chr01 Coordinates: 145551254-145553732 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2020 bp · TkA01G578800|TK1151|cDNA

AAAAGTCTGTATGGTACAAAAGTTCAACTCTTCGAAATTACTAGGGTTTTTTCTTCATTTTTGGGGCTTATTTTATCGTTTACAGTTTAAGTTATTCAGCAACCCCTTTTTTCTTATCGAAATCTAATCGAAGCTACCGAAACCCTCTCATATATTCACTCCTCTTTTTGTGGTTTGCGCTAATTTCAAATCTTCGAGAGGATTTCTTCAGAGTCTTTAATGAAAAATTGCAATGGATCCGAACACCGTGGTGCTGGAAA...

CDS

Download CDS FASTA

1461 bp · TkA01G578800|TK1151|CDS

ATGGATCCGAACACCGTGGTGCTGGAAATAAGCTCCGATGAGGATGTCGGTTGGAATGATAATAATGGTAGAGGAATTGCCGACGGCGGTGACGATCACGATTGGTTAGCAGAGCTTCTTGACGAGGTACACAAAGGGAATTTTGGTGATGATACCGACGAATTGGTGGTGGTAAGTGAAGTTTCTCCGTCTGAAAAAACCGGGAAGAAATCAAAACTAAAGTCTTCTTTACTTGACTTAGACGATGACTGTGTGATTCT...

Protein

Download Protein FASTA

486 aa · TkA01G578800|TK1151|PROTEIN

MDPNTVVLEISSDEDVGWNDNNGRGIADGGDDHDWLAELLDEVHKGNFGDDTDELVVVSEVSPSEKTGKKSKLKSSLLDLDDDCVILDKDPEKPVEVLNDKPSNVEGDSDDIVVVSEKGQVACRDYPHPRHLCIKFPFSTTPNQNHCDQCYCYVCDSLAPCVYWGNGSSPMDHCHATDKDELWKHQRKNAKNGTKVVPLPLPPVADVARFNGLHLHPHRQPPPPQPGGLIHPHHHHHHHPSGNFRPPNIITQNRRPVFPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G578800`
TK1151 ID	TkA01G578800
OH-1004 ID	LXL04_000885
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G578800

Location Chr01:145551254-145553732 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20310`	Resistance protein interactor which positively enhances RPM1-mediated resistance to necrotrophic bacterial pathogens Pseudomonas syringae pv. tomato DC3000 harboring type III effector protein AvrRpm1 or AvrB, but prevents the hypersensitive response (HR) controlled by RPM1.	The nuclear localized RIN13 induces cell death through interacting with ARF1.2020 · DOI: 10.1016/j.bbrc.2020.04.082

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000885 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008219 cell death Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010150 leaf senescence Biological Process

GO:0034051 negative regulation of plant-type hypersensitive response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1900426 positive regulation of defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G20310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.906

Rank 1 · TkA01G578800 · TK1151

Cytoplasm0.151

Rank 2 · TkA01G578800 · TK1151

Endoplasmic reticulum0.051

Rank 3 · TkA01G578800 · TK1151

Cell membrane0.047

Rank 4 · TkA01G578800 · TK1151

Plastid0.017

Rank 5 · TkA01G578800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27679RIN13_N122-190 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G578800	`PF27679`	RIN13_N	122	190	9.3e-32	109.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SK71`	Arabidopsis thaliana	sp\|Q9SK71\|RIN13_ARATH RPM1 interacting protein 13	42.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card