TkA01G578740 | RubberDandelionOmics

Gene overview

TkA01G578740

Reference: TK1151 Chr: Chr01 Coordinates: 145530987-145535971 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2101 bp · TkA01G578740|TK1151|cDNA

TGTTAACCCAGTTTAACTTGCGATACTTTTTCATATAAAACGAAATCATGTTGAATACAATGTGTGCACACAGTAACAACAGTAGACCTTCTTCTCTATCGATCAGGTGGCAGACAATGCGACTCTCTACGGCGTCTGTCTACACACACAGGAATTCGTTCAGAGACCACCGGGAATGCTCGGCGCCGCAACTCCCCTTTCACGAACAGCCGGAAGAGGCAGTCGTTTTCTGGTCACCGCACCTCGCTGTTACTGTCTCT...

CDS

Download CDS FASTA

2244 bp · TkA01G578740|TK1151|CDS

ATGTCAACAGGCCCCAGCCATAGACGCTGTAGAAGCGAAATTGTTACCTCGTTAAATACTCAAAATCAAAGTAACGGCTCCGGTTTTCAACGATTGAAGACTTCAATGCAACGAGCTTTAAATTGGGGCGGCAGCCAGGATTTCAATCAAGAGATTTTAGCTAATCAGAAACGCCAGTGGTTTCAGTTTCAATCAACTTCCTCGGATGCGTCCACAAAGTACCAAGATCCATCGTCCCTTTTTGAACATTTTCTTATAGC...

Protein

Download Protein FASTA

747 aa · TkA01G578740|TK1151|PROTEIN

MSTGPSHRRCRSEIVTSLNTQNQSNGSGFQRLKTSMQRALNWGGSQDFNQEILANQKRQWFQFQSTSSDASTKYQDPSSLFEHFLIAGIHPNANLEPVEDAFAHRKTWEDRADKTDLMDLKVMQFRSPPSVTMEPQILFKYPPGKRLSMRLGDLASFCFPTGVKACVMERTRSQNELNRVVYGQDHLTRDDSAFIFSLKVADNATLYGVCLHTQEFVQRPPGMLGAATPLSRTAGRGSRFLVTAPRCYCLLTRVPFFQLH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G578740`
TK1151 ID	TkA01G578740
OH-1004 ID	LXL04_018588
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	36.700
Protein coverage (%)	TK1151 93.440 / OH-1004 85.007 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G578740`
Location	Chr01:145530987-145535971 (-)
Description	Similar to DENND4A: C-myc promoter-binding protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018588` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0032483 regulation of Rab protein signal transduction Biological Process GO:0070374 positive regulation of ERK1 and ERK2 cascade Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005938 cell cortex Cellular Component GO:0031410 cytoplasmic vesicle Cellular Component GO:0043657 host cell Cellular Component GO:0055037 recycling endosome Cellular Component
KEGG gene cross-reference	fgr:FGSG_06284 hsa:10260 mmu:76954 vda:VDAG_01962 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.596

Rank 1 · TkA01G578740 · TK1151

Cell membrane0.226

Rank 2 · TkA01G578740 · TK1151

Nucleus0.207

Rank 3 · TkA01G578740 · TK1151

Golgi apparatus0.127

Rank 4 · TkA01G578740 · TK1151

Lysosome / Vacuole0.097

Rank 5 · TkA01G578740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12266DUF361355-76 aa

PF03456uDENN56-74 aa

PF03456uDENN135-212 aa

PF02141DENN244-283 aa

PF21756DacZ_T379-425 aa

PF21756DacZ_T517-548 aa

PF02141DENN518-620 aa

PF21756DacZ_T599-624 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G578740	`PF12266`	DUF3613	55	76	0.51	11.1
TkA01G578740	`PF03456`	uDENN	56	74	1.2e-07	32.9
TkA01G578740	`PF03456`	uDENN	135	212	1.2e-07	32.9
TkA01G578740	`PF02141`	DENN	244	283	1.7e-29	103.7
TkA01G578740	`PF21756`	DacZ_T	379	425	0.015	16.1
TkA01G578740	`PF21756`	DacZ_T	517	548	0.015	16.1
TkA01G578740	`PF02141`	DENN	518	620	1.7e-29	103.7
TkA01G578740	`PF21756`	DacZ_T	599	624	0.015	16.1
TkA01G578740	`PF12266`	DUF3613	697	718	0.51	11.1
TkA01G578740	`PF03455`	dDENN	710	735	0.0044	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card