TkA01G578730 | RubberDandelionOmics

Gene overview

TkA01G578730

Reference: TK1151 Chr: Chr01 Coordinates: 145527971-145531102 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2491 bp · TkA01G578730|TK1151|cDNA

ATTCGACGTAAATTGCAAAAATAGAACCCCCGTCGGGGACGGCGACATCGATATTGCTTTGAGAAAGAAGAACGAAGTCACACGCACAAATCAATGGAGGGTGATTCAGGATACGACGACGAAATTAGGGCTCATTTTCCCCTTTCTTTCGGCAAAAAATCCAAATCACAAACCCCAGTTGAATCAATTCACAACGCCACTCGCCGCCCCACCACCGGCGCCGACGGCTCACCATCTTCTACTAACAACAAGAACAAAGA...

CDS

Download CDS FASTA

1911 bp · TkA01G578730|TK1151|CDS

ATGGAGGGTGATTCAGGATACGACGACGAAATTAGGGCTCATTTTCCCCTTTCTTTCGGCAAAAAATCCAAATCACAAACCCCAGTTGAATCAATTCACAACGCCACTCGCCGCCCCACCACCGGCGCCGACGGCTCACCATCTTCTACTAACAACAAGAACAAAGACAGCCCCTTTCCATCATTATCCTCATCCTCCAAGTCATGGTTAAATTCCCTCCAAAAAAACCCTAAACCCAGTACTGTTTCTGCGGGTGATGT...

Protein

Download Protein FASTA

636 aa · TkA01G578730|TK1151|PROTEIN

MEGDSGYDDEIRAHFPLSFGKKSKSQTPVESIHNATRRPTTGADGSPSSTNNKNKDSPFPSLSSSSKSWLNSLQKNPKPSTVSAGDVVIGPPRPPPSSESVDEEDDAMIGPPRPMPTEDDDDDDDDDEPIIGPPRPPVASDSDDDFPGSEPGIQHRIPLSNEIVLKGHTKVVSTLAIDHSGSRVLSGSFDYTIRMYDFQGMNARLESFRQLEPSEGHQVRSLSWSPSADRFLCVTGSATAKIFDRDGLTLGEFVKGDMYI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G578730`
TK1151 ID	TkA01G578730
OH-1004 ID	LXL04_000887
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G578730`
Location	Chr01:145527971-145531102 (+)
Description	Similar to Wdr70: WD repeat-containing protein 70
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000887` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0035861 site of double-strand break Cellular Component GO:0071006 U2-type catalytic step 1 spliceosome Cellular Component GO:0019899 enzyme binding Molecular Function
KEGG gene cross-reference	bta:540724 hsa:55100 mmu:545085 rno:294783 xtr:780253 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.948

Rank 1 · TkA01G578730 · TK1151

Cytoplasm0.142

Rank 2 · TkA01G578730 · TK1151

Cell membrane0.016

Rank 3 · TkA01G578730 · TK1151

Mitochondrion0.016

Rank 4 · TkA01G578730 · TK1151

Endoplasmic reticulum0.009

Rank 5 · TkA01G578730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30552CFAP251_N150-177 aa

PF25047Beta-prop_TEP1_2nd159-202 aa

PF24817WD40_WDHD1_1st160-246 aa

PF25173Beta-prop_WDR3_1st161-200 aa

PF24807WD40_CDC20-Fz162-239 aa

PF25460Beta-prop_Aladin163-245 aa

PF25391WD40_Gbeta163-244 aa

PF25174Beta-prop_THOC3164-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G578730	`PF30552`	CFAP251_N	150	177	5.2e-05	23.3
TkA01G578730	`PF25047`	Beta-prop_TEP1_2nd	159	202	3.8e-22	79.4
TkA01G578730	`PF24817`	WD40_WDHD1_1st	160	246	1e-21	78.1
TkA01G578730	`PF25173`	Beta-prop_WDR3_1st	161	200	1.2e-25	91.0
TkA01G578730	`PF24807`	WD40_CDC20-Fz	162	239	1.8e-22	80.8
TkA01G578730	`PF25460`	Beta-prop_Aladin	163	245	9.3e-13	48.7
TkA01G578730	`PF25391`	WD40_Gbeta	163	244	5e-10	39.6
TkA01G578730	`PF25174`	Beta-prop_THOC3	164	201	2.9e-32	112.5
TkA01G578730	`PF00400`	WD40	164	197	1.1e-31	108.7
TkA01G578730	`PF25175`	Beta-prop_WDR5	164	244	1.3e-30	107.4
TkA01G578730	`PF25172`	Beta-prop_WDR3_2nd	164	197	1.2e-12	48.4
TkA01G578730	`PF24105`	Beta-prop_CAF1B_HIR1	164	244	1.4e-11	44.7
TkA01G578730	`PF24796`	WDR55	164	302	2e-10	40.9
TkA01G578730	`PF23869`	Beta-prop_WDR75_1st	164	199	5.8e-08	33.1
TkA01G578730	`PF23381`	Beta-prop_IFT122_1st	165	245	2.3e-26	93.5
TkA01G578730	`PF24814`	WD40_Prp19	165	244	4e-24	85.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card