TkA01G578460 | RubberDandelionOmics

Gene overview

TkA01G578460

Reference: TK1151 Chr: Chr01 Coordinates: 145445835-145449583 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3314 bp · TkA01G578460|TK1151|cDNA

AAAAAAATCGGTCTAAGCTTAGGTACGGTGTTAATTTCGTTAACATCGCAAAACAACATACAATTCTATCTGCGTTACGTACACATTAACGATGCATAGCTACTCTTGACTTGGCTTGATTTTCTTTTAGAAGGAGCATTTCCCTTATCCCTTCGACTGAATGGCTACCCTTTGCACACACCCACCATTGTAGTACCATAAAACCACCTCTGGTTCTCTGGCATCTGTAACAATGGCGACTCTGCAAACTATGGCGTTCT...

CDS

Download CDS FASTA

546 bp · TkA01G578460|TK1151|CDS

ATGGCGACTCTGCAAACTATGGCGTTCTCCTCACCGGTCTCTCGTTGTTGTCAAAAACCTCAATTTCATCCAGGAATGATATCGGGAGTTGTTTCTCACAGTTCCAGGTCTGCATTCAGTGGCCAAGCATTGAGTATACCAACTTCAAGGCAAACTCCCAACAGATTTAAAAACTCTCGCACATTTACTCAAACCATACAGATGGTAAAACCATCGATCCAGTTCATACCAGGAAGAGATGAACAGACAATACCAGACGT...

Protein

Download Protein FASTA

181 aa · TkA01G578460|TK1151|PROTEIN

MATLQTMAFSSPVSRCCQKPQFHPGMISGVVSHSSRSAFSGQALSIPTSRQTPNRFKNSRTFTQTIQMVKPSIQFIPGRDEQTIPDVKLTKSRDGTNGMAIFRFDEPSVFDSSGEVGDITGFFMIDDEGTLQSVDVSAKFVNGRPAGIEAKYVMRTPRDWDRFMRFMERYANVNGLQFVKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G578460`
TK1151 ID	TkA01G578460
OH-1004 ID	LXL04_000893
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G578460

Location Chr01:145445835-145449583 (+)

Description Similar to PSB28: Photosystem II reaction center PSB28 protein, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28660`	Photosystem II reaction center PSB28 protein, chloroplastic.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0938100`	Photosystem II reaction center PSB28 protein, chloroplastic.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000893 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015979 photosynthesis Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009523 photosystem II Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009654 photosystem II oxygen evolving complex Cellular Component

KEGG gene cross-reference

ath:AT4G28660

dosa:Os01g0938100

ota:OT_ostta16g00650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.984

Rank 1 · TkA01G578460 · TK1151

Mitochondrion0.023

Rank 2 · TkA01G578460 · TK1151

Nucleus0.017

Rank 3 · TkA01G578460 · TK1151

Cytoplasm0.013

Rank 4 · TkA01G578460 · TK1151

Cell membrane0.008

Rank 5 · TkA01G578460 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03912Psb2873-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G578460	`PF03912`	Psb28	73	178	1.2e-40	138.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W0Y8`	Arabidopsis thaliana	sp\|Q8W0Y8\|PSB28_ARATH Photosystem II reaction center PSB28 protein, chloroplastic	61.100%	Swiss-Prot	High
`Q0JG75`	Oryza sativa subsp. japonica	sp\|Q0JG75\|PSB28_ORYSJ Photosystem II reaction center PSB28 protein, chloroplastic	63.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card