TkA01G576380 | RubberDandelionOmics

Gene overview

TkA01G576380

Reference: TK1151 Chr: Chr01 Coordinates: 144926064-144930480 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1835 bp · TkA01G576380|TK1151|cDNA

TATAATATAAATTAAATATTATTTGATAGTTGCTCGTTGAGTCAATGTCAAGTAAAACCAAACAAAAGATTACCGAGTAAACAGTACCGTAAGGAAAGCATTAACTTTTTAACTTTTTAACATTTAGGGAGCGCGTCACAGATAAGAACTTAGGGGGCTTATTTGAAAATCTCTTTCTGTTGTTGGTTTCCTCTTGAAGTTTATAAGTAAAATCGTTATTGACTGTCAACAAGACTTCAAAGAGAAAACACAGCGTCTGT...

CDS

Download CDS FASTA

1053 bp · TkA01G576380|TK1151|CDS

ATGGAAGGGACAGTATTTACTCCTGCTTTGGAAGGAATGAAACATGTCAAGTCTGAAGAAGGCGAAATGCTTTCCAAACCCTTCTTGGAAGTCTGCAAACAGATATTACCTGTTATCGACAATTTCGGAGCAGCCATGGCACTGGTCAAAACTGATGTTGGTGGTAACATAACAAGGTTAGAGAACAAATATCTATCCAACCCAGTTGAATTTGAGAAACTATACAGTATGGTTCGGGTAGAAGTCGAAGCAAAAAAAGC...

Protein

Download Protein FASTA

350 aa · TkA01G576380|TK1151|PROTEIN

MEGTVFTPALEGMKHVKSEEGEMLSKPFLEVCKQILPVIDNFGAAMALVKTDVGGNITRLENKYLSNPVEFEKLYSMVRVEVEAKKADGSSSCTNGLLWLTRAMDFIVELFRNLMEHKDWSMSQVCSEAYTKTLKKYHGWLASSTFTVAMKLAPDRKKFMDVVGGKGDINSDIEKFCATFTPLLEENHKFLVLQNLHQEDKDKDKKQEIQIGAPTDVKHLAHVGCDGPAQESPTWDFMVQMKGYGTPDQQFASSDISDGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G576380`
TK1151 ID	TkA01G576380
OH-1004 ID	LXL04_033370
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	64.900
Protein coverage (%)	TK1151 54.571 / OH-1004 55.362 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G576380

Location Chr01:144926064-144930480 (+)

Description Similar to GLTP1: Glycolipid transfer protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g33470`	May be involved in glycolipids transfer.	No verified direct reference in this release
`At2g33460`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	No verified direct reference in this release
`At1g04450`	Functions as a downstream effector of Rho-related GTP binding proteins of the 'Rho of Plants' (ROPs) family.	A genome-wide analysis of Arabidopsis Rop-interactive CRIB motif-containing proteins that act as Rop GTPase targets.2001 · DOI: 10.1105/tpc.010218 A Rho family GTPase controls actin dynamics and tip growth via two counteracting downstream pathways in pollen tubes.2005 · DOI: 10.1083/jcb.200409140

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033370 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001576 globoside biosynthetic process Biological Process

GO:0006869 lipid transport Biological Process

GO:0015031 protein transport Biological Process

GO:0035621 ER to Golgi ceramide transport Biological Process

GO:0035627 ceramide transport Biological Process

GO:0120009 intermembrane lipid transfer Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G21360

ath:AT2G33470

ath:AT3G21260

bta:538919

dre:492502

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.656

Rank 1 · TkA01G576380 · TK1151

Cell membrane0.328

Rank 2 · TkA01G576380 · TK1151

Nucleus0.235

Rank 3 · TkA01G576380 · TK1151

Golgi apparatus0.072

Rank 4 · TkA01G576380 · TK1151

Mitochondrion0.049

Rank 5 · TkA01G576380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01025GrpE14-51 aa

PF08718GLTP25-164 aa

PF01025GrpE57-113 aa

PF08718GLTP172-207 aa

PF00786PBD180-209 aa

PF00786PBD210-230 aa

PF08718GLTP263-310 aa

PF00786PBD336-345 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G576380	`PF01025`	GrpE	14	51	0.0052	17.2
TkA01G576380	`PF08718`	GLTP	25	164	1.8e-48	165.2
TkA01G576380	`PF01025`	GrpE	57	113	0.0052	17.2
TkA01G576380	`PF08718`	GLTP	172	207	1.8e-48	165.2
TkA01G576380	`PF00786`	PBD	180	209	0.00013	22.9
TkA01G576380	`PF00786`	PBD	210	230	0.00013	22.9
TkA01G576380	`PF08718`	GLTP	263	310	1.8e-48	165.2
TkA01G576380	`PF00786`	PBD	336	345	0.00013	22.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22797`	Arabidopsis thaliana	sp\|O22797\|GLTP1_ARATH Glycolipid transfer protein 1	73.300%	Swiss-Prot	Medium
`F4IVV0`	Arabidopsis thaliana	sp\|F4IVV0\|RIC1_ARATH CRIB domain-containing protein RIC1	58.500%	Swiss-Prot	Low
`F4I5N6`	Arabidopsis thaliana	sp\|F4I5N6\|RIC3_ARATH CRIB domain-containing protein RIC3	52.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card