TkA01G576340 | RubberDandelionOmics

Gene overview

TkA01G576340

Reference: TK1151 Chr: Chr01 Coordinates: 144915052-144918169 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1977 bp · TkA01G576340|TK1151|cDNA

CTCGACTTGGTTTTGTTCATAATCGAGGGGGTTCAATACAAAGACAGATAAAACACAAAAAAAAAACCAGCGACAAATTCTATTCTAACCACCGTCTGCAAGCAGGTTCAAATCAACCAAATATGCAAATTGATTTGCACTTTGATAATTTTGGTCGCTAATTCTCACGTTTCTCGTTCATCAGTCGCTGTTGAAATCAAAGAACATTCGTCTCGTCGAATTTTTTTGTTACATTTCGCCGGATTCGTTGTTCTTCACAA...

CDS

Download CDS FASTA

1311 bp · TkA01G576340|TK1151|CDS

ATGTTGTTGAAGAAGCTTACTAGTTCTAATAGTAACACAAATGGCGATATGGAATCTTATTTTCCGATTAGGCCAGAGTGCCAAGAACTTGTTCCCAAGACCCGGTTTAAGCCCAAGGTTGGGAAAACTTTAAGTGAAAGAAGATGGAATGCTGCATTTGATACAAATGGTCGTTTGGATATAGCTGGTGTTCTTAGGAGAATACAAAGAGGGGGCATTCATCCATCAATTAAAGGGGTAGTATGGGAATTTTTATTGGG...

Protein

Download Protein FASTA

436 aa · TkA01G576340|TK1151|PROTEIN

MLLKKLTSSNSNTNGDMESYFPIRPECQELVPKTRFKPKVGKTLSERRWNAAFDTNGRLDIAGVLRRIQRGGIHPSIKGVVWEFLLGCYDPNSTTEERGALRQNRREQYASWKEECKKMAPIVGSGKFVMSPIVTDDGKPIEDNGIEQPESDSDSDKKVTQWKLSLHQIGLDVVRTDRSLIYYENEANQAKLWDVLAIYTWVDDDIGYVQGMNDICSPMVILLEEEADAFWCFEHAMRRVRENFRSNATSMGVQSQLGIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G576340`
TK1151 ID	TkA01G576340
OH-1004 ID	LXL04_000918
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.200
Protein coverage (%)	TK1151 100.000 / OH-1004 91.502 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G576340

Location Chr01:144915052-144918169 (+)

Description Similar to Tbc1d15: TBC1 domain family member 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53570`	Involved in defense response against fungal and bacterial pathogens.	RabGAP22 is required for defense to the vascular pathogen Verticillium longisporum and contributes to stomata immunity.2014 · DOI: 10.1371/journal.pone.0088187

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000918 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016192 vesicle-mediated transport Biological Process

GO:0032889 regulation of vacuole fusion, non-autophagic Biological Process

GO:0043087 regulation of GTPase activity Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005096 GTPase activator activity Molecular Function

KEGG gene cross-reference

cgr:2886868

hsa:64786

mmu:66687

spo:2543609

yli:2907695

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.560

Rank 1 · TkA01G576340 · TK1151

Nucleus0.284

Rank 2 · TkA01G576340 · TK1151

Cell membrane0.187

Rank 3 · TkA01G576340 · TK1151

Golgi apparatus0.120

Rank 4 · TkA01G576340 · TK1151

Lysosome / Vacuole0.110

Rank 5 · TkA01G576340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00566RabGAP-TBC77-114 aa

PF00566RabGAP-TBC146-313 aa

PF23436RabGap-TBC_2190-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G576340	`PF00566`	RabGAP-TBC	77	114	1.1e-37	130.6
TkA01G576340	`PF00566`	RabGAP-TBC	146	313	1.1e-37	130.6
TkA01G576340	`PF23436`	RabGap-TBC_2	190	310	1e-08	35.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94BY9`	Arabidopsis thaliana	sp\|Q94BY9\|GAP22_ARATH Rab GTPase-activating protein 22	25.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card