Gene Card
Gene overview
cDNA / CDS / Protein Sequences
902 bp · TkA01G571870|TK1151|cDNA
AAAAAATCGATGAAAAAACTTGAAAAAAAAAATTCAATTAAAAAACCAAAAAATACAGATTTGACTCTTGTTAGTGAAAAATTGTTAATTTCTTTGCCCATTATTTATATATCTGTTTACATAACGGTGTCCGGTGGTTCTTCAAGTTTCCCCAACAGGTAAGCAACCGATCACTCCTCCATTATCATTAATTTTGGATTTCTATTTTGATTAATTTGCTTCAGATGCGTGTTTCCCCTTTTGTTATTCGATTGACGATT...
453 bp · TkA01G571870|TK1151|CDS
ATGCGTGTTTCCCCTTTTGTTATTCGATTGACGATTCATAAACATCGACGGTTGCCTCCACCGATTTTGGTATCGTCAGCTATGAATACGCGAAGGGATGTGCGTGGTAACAGATCTGCTCTGTTTGATGAAATTGAAGATGGTGGAATCAGAGCCTCTTCTTCTTACTCCTCCCATGAAATTGATGAACATGAGAATGAAAGAGCAATGGATGGACTGCAAGATAGGGTTCTTATGCTGAAAAGGTTGACAGGTGATAT...
Protein
Download Protein FASTA150 aa · TkA01G571870|TK1151|PROTEIN
MRVSPFVIRLTIHKHRRLPPPILVSSAMNTRRDVRGNRSALFDEIEDGGIRASSSYSSHEIDEHENERAMDGLQDRVLMLKRLTGDIHEEVEGHNRMLDRMGNDMDSSRGLLSGTMDKFKTVFETKSSRRMFTLVASFVVGFLVIYYLTR
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G571870 |
|---|---|
| TK1151 ID | TkA01G571870 |
| OH-1004 ID | LXL04_000961 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G571870 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:143861797-143863573 (-) | |||||||||
| Description | Similar to BET11: Bet1-like SNARE 1-1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:2000156 regulation of retrograde vesicle-mediated transport, Golgi to ER Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005768 endosome Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005795 Golgi stack Cellular Component GO:0005798 Golgi-associated vesicle Cellular Component GO:0005802 trans-Golgi network Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G58170 ath:AT4G14455 bta:509758 pon:100172318 rno:54400 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF30871Sft1-BET165-126 aaPF05739SNARE65-136 aaPF06255MafB66-125 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G571870 | PF30871 | Sft1-BET1 | 65 | 126 | 1.2e-07 | 32.3 |
| TkA01G571870 | PF05739 | SNARE | 65 | 136 | 2.2e-06 | 28.1 |
| TkA01G571870 | PF06255 | MafB | 66 | 125 | 0.16 | 12.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.