Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3893 bp · TkA01G567230|TK1151|cDNA
CAAAAATCATAAAGACTAACATTGTGAAGGTTACTTGTAAAAACTATGATTTCACCTTTTACACACGACCAATGACAGTAGATCGATCGATTTAGGGTTCTTAATCTACCATCGGATTTGCTGAAGTTATAAAATTGGAGGTTTACTCGGTGGTTCTTCCCCAGTCCAAATTGATTTCACCGTCAACGATTGGAAAATTCAATTATAGTTTCACAAATAACGAGTCTCCATTTGAAACTTTTTATCAACATTCTCATCTG...
1533 bp · TkA01G567230|TK1151|CDS
ATGGGGACTGAAAATCCTAACCGTGTGAATGCCTATCCTGGACCAGCTCCTACTCCTTTTGGAGCTCCAAGAACCAACATGCCCATGTCTTCATCTAATCCCATGGTTGGTTCAGACCCCTCTGCTTTCAGGCCAACACCAGTCCCTACACCATTCTCCACTCCTGGGCCCGCAATTGGATCCATGGCTCCAGGTTTTAGACCCATGATGCAGCCAGGTAGGCCCACTCCTTCATACGGTCCACCAACTACAGGACCTCC...
Protein
Download Protein FASTA510 aa · TkA01G567230|TK1151|PROTEIN
MGTENPNRVNAYPGPAPTPFGAPRTNMPMSSSNPMVGSDPSAFRPTPVPTPFSTPGPAIGSMAPGFRPMMQPGRPTPSYGPPTTGPPQRFPTPQFPSSAQPSMPPPASGVGQPMFPPTMRPPPPGHVPPMGSPPQSLYSVPSRPNMQQPPPPTGPPSGLPGYPGVQSNRVTSPPPPPLGYAPVPPQPTTSTPFSGGYAPPQPTTSASFSGGYAPPQPSTSGPFSSHQGGYGQQPPPPVTSQPGMYGGGSAPPTGGMSGLV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G567230 |
|---|---|
| TK1151 ID | TkA01G567230 |
| OH-1004 ID | LXL04_018781 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 61.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 49.659Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G567230 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:142792377-142798650 (-) | |||||||||
| Description | Similar to At3g07100: Protein transport protein Sec24-like At3g07100 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006886 intracellular protein transport Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0007029 endoplasmic reticulum organization Biological Process GO:0007030 Golgi organization Biological Process GO:0008361 regulation of cell size Biological Process GO:0009555 pollen development Biological Process GO:0032374 regulation of cholesterol transport Biological Process GO:0032876 negative regulation of DNA endoreduplication Biological Process GO:0042632 cholesterol homeostasis Biological Process GO:0046740 transport of virus in host, cell to cell Biological Process GO:0048232 male gamete generation Biological Process GO:0050714 positive regulation of protein secretion Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G07100 bta:505089 hsa:10427 hsa:10802 mmu:77371 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07754Ribosomal_aS21356-371 aaPF04810zf-Sec23_Sec24357-395 aaPF15749MRNIP357-398 aaPF04811Sec23_trunk432-510 aaPF19088TUTase447-500 aaPF09631Sen15456-497 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G567230 | PF07754 | Ribosomal_aS21 | 356 | 371 | 0.1 | 13.2 |
| TkA01G567230 | PF04810 | zf-Sec23_Sec24 | 357 | 395 | 7.5e-18 | 65.0 |
| TkA01G567230 | PF15749 | MRNIP | 357 | 398 | 0.33 | 12.5 |
| TkA01G567230 | PF04811 | Sec23_trunk | 432 | 510 | 2.7e-31 | 109.7 |
| TkA01G567230 | PF19088 | TUTase | 447 | 500 | 0.25 | 11.8 |
| TkA01G567230 | PF09631 | Sen15 | 456 | 497 | 0.19 | 12.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.