TkA01G566030 | RubberDandelionOmics

Gene overview

TkA01G566030

Reference: TK1151 Chr: Chr01 Coordinates: 142448406-142453364 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2058 bp · TkA01G566030|TK1151|cDNA

TATGCTTTTATATTGTGTTTTGGGTGAGATCACGGAAACTATTTTAAGAGCCCTCCCTCCCTCCTCCCTTCTCTCTCTTCGTCGATTCTTCTTTCCACCACAAAATTCTGCTCCTCTCCACCACCAAAATCCCTTATTTTCAGAGTTTTGATTTTAATAAATAGATATTAATTTTTTTTGTGTAATTTGAAGTCACATCCTTGGAATCTTTGAAACTTTCTACTCTTTTTTCCAGAGGTTTAAAGGGTTTTCTAGTTTTT...

CDS

Download CDS FASTA

1230 bp · TkA01G566030|TK1151|CDS

ATGGATTTGAAGAAATTTCAAGAATCAACCGATGGCGATACTGCTACCATGAAACCCGAATCAAGAAGCGTCGGTTCTTCGCCAAAGAAATCCAGCGGTCAACTGAGTGGTTTAGGTTTGGGTTCAAAGTCAAAGGAATTTGGTAATATGAATATGAAAGATAATTTTACGAGGGCTGATAAGATTGATTTCAAGAGCTGGGATGTTCAATTGGATAAACATTTGAGTAGGGTTTGGTCGAGAGATAGAGAGAAAGAACA...

Protein

Download Protein FASTA

409 aa · TkA01G566030|TK1151|PROTEIN

MDLKKFQESTDGDTATMKPESRSVGSSPKKSSGQLSGLGLGSKSKEFGNMNMKDNFTRADKIDFKSWDVQLDKHLSRVWSRDREKEQAHTKREEWEIDLAKLDIRNVIAHGTYGTVYRGVYDGQDVAVKVLDWGEDGLATVAETANLRTSFRQEVAVWHKLDHPNVTKFVGASMGTSDLKIPSNNTSDSVQNSLPSRACCVVVEYLPGGTLKKYLIRNSRKKLSFKIVVQLALDLSRGLSYLHSKKIVHRDVKTENMLLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G566030`
TK1151 ID	TkA01G566030
OH-1004 ID	LXL04_001027
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G566030

Location Chr01:142448406-142453364 (-)

Description Similar to STY13: Serine/threonine-protein kinase STY13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50000`	Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues.	Raf-like kinases CBC1 and CBC2 negatively regulate stomatal opening by negatively regulating plasma membrane H + -ATPase phosphorylation in Arabidopsis.2020 · DOI: 10.1039/c9pp00329k
`At3g01490`	Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues.	Raf-like kinases CBC1 and CBC2 negatively regulate stomatal opening by negatively regulating plasma membrane H + -ATPase phosphorylation in Arabidopsis.2020 · DOI: 10.1039/c9pp00329k
`At2g24360`	Serine/threonine protein kinase that phosphorylates proteins on serine, threonine and tyrosine residues.	Genome-wide analysis and experimentation of plant serine/ threonine/tyrosine-specific protein kinases.2006 · DOI: 10.1007/s11103-005-4109-7
`At1g62400`	Serine/threonine/tyrosine kinase involved in the control of stomatal movement in response to CO(2).	No verified direct reference in this release
`At2g17700`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001027 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001659 temperature homeostasis Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009637 response to blue light Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0010114 response to red light Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0071244 cellular response to carbon dioxide Biological Process

GO:0090333 regulation of stomatal closure Biological Process

KEGG gene cross-reference

ath:AT1G62400

ath:AT2G17700

ath:AT2G24360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.523

Rank 1 · TkA01G566030 · TK1151

Cytoplasm0.445

Rank 2 · TkA01G566030 · TK1151

Nucleus0.289

Rank 3 · TkA01G566030 · TK1151

Golgi apparatus0.065

Rank 4 · TkA01G566030 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA01G566030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17667Pkinase_fungal89-130 aa

PF07714PK_Tyr_Ser-Thr103-380 aa

PF00069Pkinase107-379 aa

PF03109ABC1107-131 aa

PF03109ABC1200-279 aa

PF12330Haspin_kinase207-279 aa

PF14531Kinase-like220-327 aa

PF17667Pkinase_fungal238-312 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G566030	`PF17667`	Pkinase_fungal	89	130	3e-05	23.7
TkA01G566030	`PF07714`	PK_Tyr_Ser-Thr	103	380	2.4e-58	198.2
TkA01G566030	`PF00069`	Pkinase	107	379	4.4e-49	168.0
TkA01G566030	`PF03109`	ABC1	107	131	0.0002	21.3
TkA01G566030	`PF03109`	ABC1	200	279	0.0002	21.3
TkA01G566030	`PF12330`	Haspin_kinase	207	279	0.087	12.6
TkA01G566030	`PF14531`	Kinase-like	220	327	9.8e-05	22.5
TkA01G566030	`PF17667`	Pkinase_fungal	238	312	3e-05	23.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGB1`	Arabidopsis thaliana	sp\|Q9FGB1\|CBC2_ARATH Serine/threonine-protein kinase 52	66.500%	Swiss-Prot	High
`Q9SSA4`	Arabidopsis thaliana	sp\|Q9SSA4\|CBC1_ARATH Serine/threonine-protein kinase 54	62.500%	Swiss-Prot	High
`Q9ZQ31`	Arabidopsis thaliana	sp\|Q9ZQ31\|STY13_ARATH Serine/threonine-protein kinase STY13	38.500%	Swiss-Prot	Medium
`Q2MHE4`	Arabidopsis thaliana	sp\|Q2MHE4\|HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1	37.100%	Swiss-Prot	Medium
`O22558`	Arabidopsis thaliana	sp\|O22558\|STY8_ARATH Serine/threonine-protein kinase STY8	37.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card