TkA01G562020 | RubberDandelionOmics

Gene overview

TkA01G562020

Reference: TK1151 Chr: Chr01 Coordinates: 141321646-141323428 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1156 bp · TkA01G562020|TK1151|cDNA

CGACGAGATAGTTTATGTGGAGATCTTTATAAATTGTTTATTTTGAGTGAAGTCTATCATGTGAAAATTGGACTAAATGAGCACATAGATTACCAAAAATAAAAAGAATACGACTACAGAGACTCGTTGACGGAGCATTTGAATGGCATAAACAACAAAGTCAATTGATTCAATCGATAGCCAGATGACATTTGCTGGCACTCCAGCAACTTTTCATTCAATTCCATGCTATCTCAAATCTAAATTAATCCAAAACCTTT...

CDS

Download CDS FASTA

510 bp · TkA01G562020|TK1151|CDS

ATGGGTGCTGCTTCCTCTGTTCCTGAAAATTCGATTCATGAATTTACTGTCAAGGATAGCAAAAGGAAGGATGTAGATCTTAGCATCTACAAAGGGAAAGTTCTTCTTGTTGTTAATGTTGCCTCTAAATGTGGATTAACAAACTCAAACTACCCAAAATTGACTGAGCTTTACGAAAAGTACAGAGTTAAAGGTCTCGAGATCCTGGCCTTTCCTTGCAATCAATTCATGAAACAAGAACCGGAATCAAGCGAGAAAGT...

Protein

Download Protein FASTA

169 aa · TkA01G562020|TK1151|PROTEIN

MGAASSVPENSIHEFTVKDSKRKDVDLSIYKGKVLLVVNVASKCGLTNSNYPKLTELYEKYRVKGLEILAFPCNQFMKQEPESSEKVEEFACTRFNATYPIFQKIRVNGPKTAPVYKFLKAKKGGFLGSSIKWNFTKFLVDKEGRVIGRYGPTTSPLSIQGDIQKALNA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G562020`
TK1151 ID	TkA01G562020
OH-1004 ID	LXL04_036994
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	65.100
Protein coverage (%)	TK1151 98.817 / OH-1004 85.787 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G562020

Location Chr01:141321646-141323428 (-)

Description Similar to GPX4: Probable glutathione peroxidase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63080`	May constitute a glutathione peroxidase-like protective system against oxidative stresses.	No verified direct reference in this release
`At2g48150`	May constitute a glutathione peroxidase-like protective system against oxidative stresses.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036994 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0004601 peroxidase activity Molecular Function

GO:0004602 glutathione peroxidase activity Molecular Function

GO:0047066 phospholipid-hydroperoxide glutathione peroxidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G48150

ath:AT3G63080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.458

Rank 1 · TkA01G562020 · TK1151

Cell membrane0.221

Rank 2 · TkA01G562020 · TK1151

Endoplasmic reticulum0.203

Rank 3 · TkA01G562020 · TK1151

Mitochondrion0.200

Rank 4 · TkA01G562020 · TK1151

Nucleus0.160

Rank 5 · TkA01G562020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08534Redoxin10-71 aa

PF00578AhpC-TSA11-77 aa

PF00255GSHPx12-120 aa

PF26557Cullin_AB16-97 aa

PF13905Thioredoxin_832-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G562020	`PF08534`	Redoxin	10	71	1.4e-06	28.9
TkA01G562020	`PF00578`	AhpC-TSA	11	77	1.8e-07	31.8
TkA01G562020	`PF00255`	GSHPx	12	120	2.9e-39	133.7
TkA01G562020	`PF26557`	Cullin_AB	16	97	0.2	12.3
TkA01G562020	`PF13905`	Thioredoxin_8	32	76	0.037	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYB4`	Arabidopsis thaliana	sp\|Q9LYB4\|GPX5_ARATH Probable glutathione peroxidase 5	71.000%	Swiss-Prot	High
`Q8L910`	Arabidopsis thaliana	sp\|Q8L910\|GPX4_ARATH Probable glutathione peroxidase 4	67.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card