Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1795 bp · TkA01G561270|TK1151|cDNA
CTTAAATCCCATTACATGTCATCACCGAACCTTCCACGTAGGCCCGGACAACCGTTGGCTCTTCCCAAAGCTAACCCTACATCTACAACAAGAAGTCAAGAACCTCAAAATTAACATTAACAAATTTCATCAAATAAACAAAGAGAATGTAGTATGTAGTCATTGCTCCTTCTCTAAGAAGCCAAAACGCCCCACCTCCTCTGCGTTTGCGTTCCCCCCAAGCCATTACCATTTACCACCATCATCACCACTTTCTCTCT...
1179 bp · TkA01G561270|TK1151|CDS
ATGTGGTTCCTCGGGGTGATTCTTCTTCTTCTTCATCGATTTCGGTTTTGTTCTGCTATTTTGGATCCTGTTGATTTTTTGGCGTTACAATCGATTAGAAAATCGCTGGAAGATATGCCAGGGTCTAATTACTTTTCGTCATGGGATTTCACTTCTGATCCATGTAATTTCGCCGGCGTTTATTGCGAAGGGGAGAAGGTTGTTGCGTTGAACCTTGGTGATCCACGAGCCGGTGCTCCTGGTTTATCCGGCCGACTTAA...
Protein
Download Protein FASTA392 aa · TkA01G561270|TK1151|PROTEIN
MWFLGVILLLLHRFRFCSAILDPVDFLALQSIRKSLEDMPGSNYFSSWDFTSDPCNFAGVYCEGEKVVALNLGDPRAGAPGLSGRLNPAIGKLTALAEFTVVPGRIMGALPSTLSQLKNLRFLAVSRNFISHEIPATLGELRWLRTLDLSYNQLTGGVPWAIGSLPSLTNLILCHNHLSGSIPHFASQSLARLDLKHNDFSGSIAPGSLPPSLQYLSLSWNRFSGQVDRLLSRLNRLSYLDLSLNQFNGPIPGCIFSFPI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G561270 |
|---|---|
| TK1151 ID | TkA01G561270 |
| OH-1004 ID | LXL04_001095 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 87.500Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G561270 |
|---|---|
| Location | Chr01:141139939-141141831 (-) |
| Description | Similar to ERECTA: LRR receptor-like serine/threonine-protein kinase ERECTA |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0001558 regulation of cell growth Biological Process GO:0009664 plant-type cell wall organization Biological Process GO:0009944 polarity specification of adaxial/abaxial axis Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0010087 phloem or xylem histogenesis Biological Process GO:0010103 stomatal complex morphogenesis Biological Process GO:0010148 transpiration Biological Process GO:0010286 heat acclimation Biological Process GO:0030155 regulation of cell adhesion Biological Process GO:0042659 regulation of cell fate specification Biological Process GO:0042742 defense response to bacterium Biological Process GO:0048281 inflorescence morphogenesis Biological Process |
| KEGG gene cross-reference | ath:AT2G26330 ath:AT3G51740 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08263LRRNT_225-62 aaPF23598LRR_1487-246 aaPF29247LRR_MHP1-HER1-GIP3109-128 aaPF05725FNIP110-117 aaPF13855LRR_8111-154 aaPF23211LRR_LRWD1111-176 aaPF25013LRR_Zer-1112-128 aaPF14580LRR_9113-132 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G561270 | PF08263 | LRRNT_2 | 25 | 62 | 5.5e-09 | 36.9 |
| TkA01G561270 | PF23598 | LRR_14 | 87 | 246 | 3.8e-08 | 33.2 |
| TkA01G561270 | PF29247 | LRR_MHP1-HER1-GIP3 | 109 | 128 | 0.11 | 12.3 |
| TkA01G561270 | PF05725 | FNIP | 110 | 117 | 0.0032 | 18.3 |
| TkA01G561270 | PF13855 | LRR_8 | 111 | 154 | 3.7e-15 | 56.2 |
| TkA01G561270 | PF23211 | LRR_LRWD1 | 111 | 176 | 0.042 | 14.3 |
| TkA01G561270 | PF25013 | LRR_Zer-1 | 112 | 128 | 0.025 | 15.5 |
| TkA01G561270 | PF14580 | LRR_9 | 113 | 132 | 0.011 | 16.0 |
| TkA01G561270 | PF24758 | LRR_At5g56370 | 115 | 179 | 0.02 | 15.3 |
| TkA01G561270 | PF12799 | LRR_4 | 118 | 155 | 6.3e-14 | 52.4 |
| TkA01G561270 | PF13516 | LRR_6 | 118 | 128 | 1.5e-06 | 28.5 |
| TkA01G561270 | PF00560 | LRR_1 | 119 | 141 | 1.1e-23 | 78.8 |
| TkA01G561270 | PF25013 | LRR_Zer-1 | 137 | 196 | 0.025 | 15.5 |
| TkA01G561270 | PF14580 | LRR_9 | 141 | 179 | 0.011 | 16.0 |
| TkA01G561270 | PF13516 | LRR_6 | 142 | 156 | 1.5e-06 | 28.5 |
| TkA01G561270 | PF00560 | LRR_1 | 144 | 165 | 1.1e-23 | 78.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.