TkA01G561260 | RubberDandelionOmics

Gene overview

TkA01G561260

Reference: TK1151 Chr: Chr01 Coordinates: 141136209-141137528 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

780 bp · TkA01G561260|TK1151|cDNA

GATATCGTAAACAGCGCATGGGACCCACGCATCGACGTGCTATTCTTCTCTGAAACCACCGCCATATTCCCAGCCGGAAAGTTCAGGGACTTCATTCTTGACGTTAAGAAGTTGCGAGACCTAAATCCGGACAAATTTTGTGGCATCGACATCTACAACGGACTTCTAATACGATTCATCAGGGCATCAACAACGTATTTAGGTCAATCTACAGATTCGGTGGTGGTCGACTTCAATTACTATCGAGCAGACTCGGGAAC...

CDS

Download CDS FASTA

780 bp · TkA01G561260|TK1151|CDS

GATATCGTAAACAGCGCATGGGACCCACGCATCGACGTGCTATTCTTCTCTGAAACCACCGCCATATTCCCAGCCGGAAAGTTCAGGGACTTCATTCTTGACGTTAAGAAGTTGCGAGACCTAAATCCGGACAAATTTTGTGGCATCGACATCTACAACGGACTTCTAATACGATTCATCAGGGCATCAACAACGTATTTAGGTCAATCTACAGATTCGGTGGTGGTCGACTTCAATTACTATCGAGCAGACTCGGGAAC...

Protein

Download Protein FASTA

259 aa · TkA01G561260|TK1151|PROTEIN

DIVNSAWDPRIDVLFFSETTAIFPAGKFRDFILDVKKLRDLNPDKFCGIDIYNGLLIRFIRASTTYLGQSTDSVVVDFNYYRADSGTTPRLNQDVMEEVEQMAFVKYGARPHWAKNRKVAFSKVEKKYEGFNGFVAAKMKLDPNDVFSSESSDELLFGRKGENDFDGCGLEGECVCSEHRHCSPTNGYFVDLGLFTKKHVFVDIHHHHSQMSIWVCFFVDIHHHHSQRKHVLLVDVLPLSNNKFPNNLGSILREKKFKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G561260`
TK1151 ID	TkA01G561260
OH-1004 ID	LXL04_015610
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.000
Protein coverage (%)	TK1151 76.448 / OH-1004 34.310 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G561260

Location Chr01:141136209-141137528 (+)

Description Similar to GULLO3: L-gulonolactone oxidase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11540`	Catalyzes the oxidation of L-gulono-1,4-lactone to ascorbic acid.	No verified direct reference in this release
`At2g46740`	Catalyzes the oxidation of L-gulono-1,4-lactone to ascorbic acid.	No verified direct reference in this release
`At2g46760`	May be involved in the biosynthesis of ascorbic acid.	No verified direct reference in this release
`At2g46750`	Catalyzes the oxidation of L-gulono-1,4-lactone to ascorbic acid.	The contribution of Arabidopsis homologs of L-gulono-1,4-lactone oxidase to the biosynthesis of ascorbic acid.2010 · DOI: 10.1271/bbb.100157
`At5g56470`	May be involved in the biosynthesis of ascorbic acid.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015610 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019853 L-ascorbic acid biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0003885 D-arabinono-1,4-lactone oxidase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0050105 L-gulonolactone oxidase activity Molecular Function

GO:0071949 FAD binding Molecular Function

KEGG gene cross-reference

ath:AT1G32300

ath:AT2G46740

ath:AT2G46750

ath:AT2G46760

ath:AT5G11540

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.282

Rank 1 · TkA01G561260 · TK1151

Lysosome / Vacuole0.258

Rank 2 · TkA01G561260 · TK1151

Extracellular0.237

Rank 3 · TkA01G561260 · TK1151

Cytoplasm0.140

Rank 4 · TkA01G561260 · TK1151

Cell membrane0.077

Rank 5 · TkA01G561260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04030ALO57-150 aa

PF22906GULLO2-like_3rd166-193 aa

PF17492D_CNTX166-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G561260	`PF04030`	ALO	57	150	2.6e-11	44.5
TkA01G561260	`PF22906`	GULLO2-like_3rd	166	193	4e-11	43.1
TkA01G561260	`PF17492`	D_CNTX	166	189	0.42	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYD8`	Arabidopsis thaliana	sp\|Q9LYD8\|GGLO3_ARATH L-gulonolactone oxidase 3	64.800%	Swiss-Prot	High
`O81030`	Arabidopsis thaliana	sp\|O81030\|GGLO5_ARATH L-gulonolactone oxidase 5	43.100%	Swiss-Prot	Medium
`O81032`	Arabidopsis thaliana	sp\|O81032\|GGLO6_ARATH Probable L-gulonolactone oxidase 6	43.700%	Swiss-Prot	Medium
`Q6NQ66`	Arabidopsis thaliana	sp\|Q6NQ66\|GGLO2_ARATH L-gulonolactone oxidase 2	42.200%	Swiss-Prot	Medium
`Q9FM84`	Arabidopsis thaliana	sp\|Q9FM84\|GGLO7_ARATH Probable truncated L-gulonolactone oxidase 7, mitochondrial	42.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card