TkA01G558190 | RubberDandelionOmics

Gene overview

TkA01G558190

Reference: TK1151 Chr: Chr01 Coordinates: 140415008-140419993 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2145 bp · TkA01G558190|TK1151|cDNA

TATACTTTCACATATTTTCAAGCAGCACAACCTTCCGCCTGCAACCGATCTTCTCTTCCGCCAATCCATGGCGAACCCCGCCGTACCCAAACGTAAACACCCAAAGAGGAGATCGGAGACTTTTATTGATAAATTTTACAAGAATCCAAAACTTCATTTGCTTTTGCTTTGCTTCTTACTGATGCGGTCCTTACCGCCCTCATCATCGCTTATGTTCCTTATACAAAGATTGATTGGGATGCTTACATGTCTCAGGTTGA...

CDS

Download CDS FASTA

1152 bp · TkA01G558190|TK1151|CDS

ACAACCTTCCGCCTGCAACCGATCTTCTCTTCCGCCAATCCATGGCGAACCCCGCCGTACCCAAACGTTGATGGCTTTATTGAAGGAGAAAGAGATTACAGCAATCTGAAAGGGGACACAGGACCTTTGGTTTATCCTGCTGGCTTTCTTTATATTTACTCCGCCATACAGTATGTTACAGGAGGCCATGTCTTTCCTGCCCAGATTCTATTTGGCTTTCTCTACATCATGAATCTTGGAATAATGTTATTCATTTATGT...

Protein

Download Protein FASTA

383 aa · TkA01G558190|TK1151|PROTEIN

TTFRLQPIFSSANPWRTPPYPNVDGFIEGERDYSNLKGDTGPLVYPAGFLYIYSAIQYVTGGHVFPAQILFGFLYIMNLGIMLFIYVKTDVVPWWALALLSLSKRLHSIFVLRLFNDCFAMTLLHASLVPLLYQKWHLGLIIFSAAVSVKMNVLLFAPSLFLLMVKGMDIMGVISALTGAALVQIVLGFPFLWSYPFAYLSNAFNLGRVFIHFWSVNFKFVPESIFVSKEFALILLVAHLSLLTIFAHYRWFKHEGGLVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G558190`
TK1151 ID	TkA01G558190
OH-1004 ID	LXL04_001136
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.100
Protein coverage (%)	TK1151 94.256 / OH-1004 78.993 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G558190

Location Chr01:140415008-140419993 (+)

Description Similar to ALG3: Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47760`	May catalyze mannosyl transfer during biosynthesis of protein N-glycosylation precursors.	Identification of the gene encoding the alpha1,3-mannosyltransferase (ALG3) in Arabidopsis and characterization of downstream n-glycan processing.2008 · DOI: 10.1105/tpc.108.060731 Arabidopsis thaliana ALG3 mutant synthesizes immature oligosaccharides in the ER and accumulates unique N-glycans.2010 · DOI: 10.1093/glycob/cwq028

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001136 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0006488 dolichol-linked oligosaccharide biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0098553 lumenal side of endoplasmic reticulum membrane Cellular Component

GO:0000033 alpha-1,3-mannosyltransferase activity Molecular Function

GO:0052925 dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G47760

cnb:CNBI2040

hsa:10195

mmu:208624

ncr:NCU06552

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.885

Rank 1 · TkA01G558190 · TK1151

Nucleus0.069

Rank 2 · TkA01G558190 · TK1151

Golgi apparatus0.064

Rank 3 · TkA01G558190 · TK1151

Cytoplasm0.056

Rank 4 · TkA01G558190 · TK1151

Cell membrane0.038

Rank 5 · TkA01G558190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05208ALG322-352 aa

PF26314MptA_B_family45-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G558190	`PF05208`	ALG3	22	352	1.4e-119	400.5
TkA01G558190	`PF26314`	MptA_B_family	45	165	0.0057	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82244`	Arabidopsis thaliana	sp\|O82244\|ALG3_ARATH Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase	68.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card