TkA01G556820 | RubberDandelionOmics

Gene overview

TkA01G556820

Reference: TK1151 Chr: Chr01 Coordinates: 139996122-140000913 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2477 bp · TkA01G556820|TK1151|cDNA

GAAGATCCCTAATATACACTGTTTAATCCAAATTGGAAAATTCAGTTTTATCTAAATAACGAAGAAAACTGGTTCGTGTCTGATTTGAAGAGTACGAAGGCATTCCCTGATTTACCCAAGATTGAATTATCAAGAATTCGAGATAATATACGCAACGCAAAGTACATTGGGTGTACTTTGGTGAACGTGAAATTGATGTGGCGATGGTAAAAGCCGTTCCACCCATAGCCTTTTAGAAAGCAGTTGCATCATATATTTGA...

CDS

Download CDS FASTA

1689 bp · TkA01G556820|TK1151|CDS

ATGAAGTACGTCTTGGTCACTGGAGGGGTGGTAAGTGGTCTCGGTAAGGGCGTCACCGCCAGTAGCATTGGCGTTGTTCTCAAGGCTTGTGGCCTTCGCGTCACCTCCATCAAAATCGATCCATACTTAAACACAGATGCTGGTACAATGTCTCCCTTTGAACACGGGGAGGTTTTTGTTCTTGACGATGGTGGAGAGGTTGACCTAGATTTGGGCAACTATGAGCGGTTCTTAGACGTGAGGCTTACTAGAGACAACAA...

Protein

Download Protein FASTA

562 aa · TkA01G556820|TK1151|PROTEIN

MKYVLVTGGVVSGLGKGVTASSIGVVLKACGLRVTSIKIDPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYERFLDVRLTRDNNITTGKIYQSVLEKERKGDYLGKTVQVVPHITDAIKDWIESVSAIPVDGKVGPADVCVIELGGTVGDIESMPFIEALRQLFFSTGPDNFCLIHVSLVPVLGVVGEQKTKPTQHSVRELRALGLTPHFLACRSAQPLLENTKQKLSQFCHVPGANILNIHDVPNIWHVPLLLRNQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G556820`
TK1151 ID	TkA01G556820
OH-1004 ID	LXL04_023437
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	74.300
Protein coverage (%)	TK1151 99.110 / OH-1004 83.383 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G556820`
Location	Chr01:139996122-140000913 (-)
Description	Similar to Ctps1: CTP synthase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023437` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006241 CTP biosynthetic process Biological Process GO:0008654 phospholipid biosynthetic process Biological Process GO:0019856 pyrimidine nucleobase biosynthetic process Biological Process GO:0032480 negative regulation of type I interferon production Biological Process GO:0044210 'de novo' CTP biosynthetic process Biological Process GO:0140861 DNA repair-dependent chromatin remodeling Biological Process GO:1902340 negative regulation of chromosome condensation Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0097268 cytoophidium Cellular Component
KEGG gene cross-reference	cge:100689101 ddi:DDB_G0280567 mmu:51797 xla:444477 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.783

Rank 1 · TkA01G556820 · TK1151

Nucleus0.351

Rank 2 · TkA01G556820 · TK1151

Mitochondrion0.081

Rank 3 · TkA01G556820 · TK1151

Peroxisome0.055

Rank 4 · TkA01G556820 · TK1151

Cell membrane0.043

Rank 5 · TkA01G556820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06418CTP_synth_N2-272 aa

PF01656CbiA12-47 aa

PF00117GATase309-543 aa

PF07722Peptidase_C26385-527 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G556820	`PF06418`	CTP_synth_N	2	272	2.8e-123	411.2
TkA01G556820	`PF01656`	CbiA	12	47	0.0055	17.4
TkA01G556820	`PF00117`	GATase	309	543	8.3e-39	133.9
TkA01G556820	`PF07722`	Peptidase_C26	385	527	3.3e-05	24.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card