TkA01G555300 | RubberDandelionOmics

Gene overview

TkA01G555300

Reference: TK1151 Chr: Chr01 Coordinates: 139667986-139669761 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1665 bp · TkA01G555300|TK1151|cDNA

GTCCTTGGAAAAAGGGGGGTAATATTTTTCCTTCAAGTCCTGTAACTCTCGCTCTCACTCATTAGTCATTTCTCACCCTCTCTGTCGAGGCCTACGAACCCACCGGCGTTTTTCGTCACCCTTAACCGCTGGCTATAGTGCGATACCAGATGATTCGCTGCTTTAGTATTTTTCAGTTTCATGATTTGATTAACATGAATTTTTTTGTTTCTGAGTAGTGATTGATTAGTCACGAGAATCCAGTCCACAGCGGACGCTTG...

CDS

Download CDS FASTA

738 bp · TkA01G555300|TK1151|CDS

ATGGCTGTTCTTTGGAATCCTTCGATTAGAAAATCAATCGCTGTTCTTATGCCTGATTTCGGGGTTTGTCCTAACACTGGTGACCCCATCGAACCATCGATTGGTTTTGGGGTTTGTCCTGTGACTAACGACCCCAAGATTATGGCGCTTACAGGATCCTCTGTATTTATGATTTACACGTTGAATACCGGGAGATGGAGAAGTCTACCTACCAATCTGCCCACTTTTCGAACTCGAAAATTCTTTTTCTCTGTAGTTAC...

Protein

Download Protein FASTA

245 aa · TkA01G555300|TK1151|PROTEIN

MAVLWNPSIRKSIAVLMPDFGVCPNTGDPIEPSIGFGVCPVTNDPKIMALTGSSVFMIYTLNTGRWRSLPTNLPTFRTRKFFFSVVTDRFIYWNVELKNLQMIMSFDLISESFDLIDLPDSIVRRNPWVVRISKIRDSLALLQDGDDYKSSIVWMMEAGAQKSFTKLFTITTPHENIVGFSKIGIPIMTILDEDYDDYDLTRFLVFETNSEHNSVLEICKMQYHFFVHSYMETLLLLGRSDYSSY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G555300`
TK1151 ID	TkA01G555300
OH-1004 ID	LXL04_001206
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.000
Protein coverage (%)	TK1151 100.000 / OH-1004 66.576 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G555300

Location Chr01:139667986-139669761 (+)

Description Similar to At1g47730: Putative F-box protein At1g47730

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47150`	Putative F-box protein At3g47150.	No verified direct reference in this release
`At1g30790`	F-box protein At1g30790.	No verified direct reference in this release
`At1g47790`	Putative F-box protein At1g47790.	No verified direct reference in this release
`At1g15015`	F-box protein At1g15015.	No verified direct reference in this release
`At3g23880`	F-box/kelch-repeat protein At3g23880.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001206 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G47730

ath:AT1G47790

ath:AT2G21930

ath:AT3G06240

ath:AT3G23880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.633

Rank 1 · TkA01G555300 · TK1151

Nucleus0.374

Rank 2 · TkA01G555300 · TK1151

Cell membrane0.127

Rank 3 · TkA01G555300 · TK1151

Endoplasmic reticulum0.068

Rank 4 · TkA01G555300 · TK1151

Lysosome / Vacuole0.049

Rank 5 · TkA01G555300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08268FBA_33-169 aa

PF23635Beta-prop_AT5G49610-like53-150 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G555300	`PF08268`	FBA_3	3	169	2.8e-10	40.4
TkA01G555300	`PF23635`	Beta-prop_AT5G49610-like	53	150	0.0098	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD58`	Arabidopsis thaliana	sp\|Q9SD58\|FB196_ARATH Putative F-box protein At3g47150	36.700%	Swiss-Prot	Medium
`Q9SY20`	Arabidopsis thaliana	sp\|Q9SY20\|FB20_ARATH F-box protein At1g30790	45.000%	Swiss-Prot	Low
`Q9FZF8`	Arabidopsis thaliana	sp\|Q9FZF8\|FB44_ARATH Putative F-box protein At1g47790	32.700%	Swiss-Prot	Medium
`Q9M9Q4`	Arabidopsis thaliana	sp\|Q9M9Q4\|FB9_ARATH F-box protein At1g15015	33.000%	Swiss-Prot	Medium
`Q9LIR8`	Arabidopsis thaliana	sp\|Q9LIR8\|FBK67_ARATH F-box/kelch-repeat protein At3g23880	51.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card