TkA01G554780 | RubberDandelionOmics

Gene overview

TkA01G554780

Reference: TK1151 Chr: Chr01 Coordinates: 139533439-139535354 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1805 bp · TkA01G554780|TK1151|cDNA

AAAAAACCCACTTTATTTGCCCCATATAAGCATTCTAGTCTATTTTAAAAAAGCATGTGGTTTGTGCATACTCCACGTGTGCGTTTGTGAGAGAACGGTGGCACCAACCCACTTTACAACCCAGAAAACGGAGGTAGCTACCGATTTACGGATGTTAATAAGTTATACAATCACCGTCCTTGGAAAAAGGGGGTAATTTTTGTCCTTCAACTCCTGTAACTCTCACTCTCACTTTCACTCTCATGCTGTAGCGTGACACC...

CDS

Download CDS FASTA

1107 bp · TkA01G554780|TK1151|CDS

ATGTCAGACCAAATCCCATTCCATATTCAAGAGGAAATCATGAACCGACTTCCCGTGAAATCATTGGTTCAATTCAGATGTGTCTCAAAAGCATGGAAGTCTTTGATCGATAGCTCCGAGTTCATTGCTGCTCACAGTCTCCGCCGCCACACTCAGCCTCATTATCTGCTCGTATCATATGAAAATCCACTAGTAGAAGAAGACTATGTCCTCTTCTCCCGATGTTATACCAATGACGACATTTTCCCCCAACAATCGTA...

Protein

Download Protein FASTA

368 aa · TkA01G554780|TK1151|PROTEIN

MSDQIPFHIQEEIMNRLPVKSLVQFRCVSKAWKSLIDSSEFIAAHSLRRHTQPHYLLVSYENPLVEEDYVLFSRCYTNDDIFPQQSYVPTLPQSVKQLILPSVVGSSQGLLCLHGSHPNFQTHMAVLWNPSIRKSIAVLMPYFGVCPYTRDPIQPSIGFGVCPITNDPKIVANTSSSEFMIYTLSTGKWRSLPTNLPPKRIQGLFYSVVIDRFIYWEVELKDLKTIMSFDLISESFELIDLPDSLACGDPWVVSISKLRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G554780`
TK1151 ID	TkA01G554780
OH-1004 ID	LXL04_001206
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G554780

Location Chr01:139533439-139535354 (+)

Description Similar to At1g47730: Putative F-box protein At1g47730

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23880`	F-box/kelch-repeat protein At3g23880.	No verified direct reference in this release
`At1g47730`	Putative F-box protein At1g47730.	No verified direct reference in this release
`At4g12560`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	An F-box gene, CPR30, functions as a negative regulator of the defense response in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03995.x
`At1g50870`	Putative F-box protein At1g50870.	No verified direct reference in this release
`At1g11270`	F-box protein At1g11270.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001206 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G47730

ath:AT1G47790

ath:AT2G21930

ath:AT3G06240

ath:AT3G23880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.667

Rank 1 · TkA01G554780 · TK1151

Nucleus0.388

Rank 2 · TkA01G554780 · TK1151

Cell membrane0.105

Rank 3 · TkA01G554780 · TK1151

Endoplasmic reticulum0.073

Rank 4 · TkA01G554780 · TK1151

Lysosome / Vacuole0.042

Rank 5 · TkA01G554780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box4-41 aa

PF12937F-box-like4-38 aa

PF08268FBA_393-285 aa

PF23635Beta-prop_AT5G49610-like175-260 aa

PF00646F-box229-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G554780	`PF00646`	F-box	4	41	8e-11	42.1
TkA01G554780	`PF12937`	F-box-like	4	38	0.00023	21.6
TkA01G554780	`PF08268`	FBA_3	93	285	1.5e-12	47.9
TkA01G554780	`PF23635`	Beta-prop_AT5G49610-like	175	260	0.073	13.0
TkA01G554780	`PF00646`	F-box	229	245	8e-11	42.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIR8`	Arabidopsis thaliana	sp\|Q9LIR8\|FBK67_ARATH F-box/kelch-repeat protein At3g23880	26.500%	Swiss-Prot	Low
`Q9SXA0`	Arabidopsis thaliana	sp\|Q9SXA0\|FB42_ARATH Putative F-box protein At1g47730	26.400%	Swiss-Prot	Low
`Q9SU30`	Arabidopsis thaliana	sp\|Q9SU30\|CPR1_ARATH F-box protein CPR1	24.800%	Swiss-Prot	Low
`Q9C6J3`	Arabidopsis thaliana	sp\|Q9C6J3\|FB52_ARATH Putative F-box protein At1g50870	25.600%	Swiss-Prot	Low
`Q7X7A9`	Arabidopsis thaliana	sp\|Q7X7A9\|FB4_ARATH F-box protein At1g11270	26.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card