RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G549570
Reference: TK1151 Chr: Chr01 Coordinates: 138078039-138082447 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3147 bp · TkA01G549570|TK1151|cDNA

AAAAAGAATACCACCGTCACCGTACCAGGTATTGAAAAGGTTCAAGTGGTCTTGAATCAAGAGCAGTAAGCCGCACTTTCCTCACTTCTCCATTCCAACATTCATCTCTCTACTTTGATCAATGGCTTCTTCTTCATCTTCTTCCATGGCAACTGCTCAACGATGTTTTAGTCATGATGTCTTTTTAAGTTTTCGAGGGGAAACTCGTCACCAATTTACGGATCATCTCCATCAAGCATTGAAGCGAGAACGAATACGCA...

CDS

Download CDS FASTA

3405 bp · TkA01G549570|TK1151|CDS

ATGGCTTCTTCTTCATCTTCTTCCATGGCAACTGCTCAACGATGTTTTAGTCATGATGTCTTTTTAAGTTTTCGAGGGGAAACTCGTCACCAATTTACGGATCATCTCCATCAAGCATTGAAGCGAGAACGAATACGCATTTTCCGGGATGATGGAATTGAGAGAGGAAAAATACTGAAGGACGAGCTAGAGAAAGCCATCCATGAATCTGAGATCTCACTCGTTGTCTTCTCAGACGACTATGCATCCTCCAAATGGTG...

Protein

Download Protein FASTA

1135 aa · TkA01G549570|TK1151|PROTEIN

MASSSSSSMATAQRCFSHDVFLSFRGETRHQFTDHLHQALKRERIRIFRDDGIERGKILKDELEKAIHESEISLVVFSDDYASSKWCLHEVMMIIKEHETSSHKHDLVPVFYKVDTSDVKHQTGSFKKAFDDYEDEIKAETDLKKKTELALKVRAWRDSLNKATNFTGYVYEIGYESEFIKKVVDTVISKIDYKLLYVSDKLVGIDEDVAEIQPWLQDTSPDAVVLLIDGMGGIGKSTIAKCIFNLHFRNYDASCFLADI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G549570
TK1151 IDTkA01G549570
OH-1004 IDLXL04_001291
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)93.600
Protein coverage (%)TK1151 100.000 / OH-1004 99.667
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G549570
LocationChr01:138078039-138082447 (+)
DescriptionSimilar to RUN1: Disease resistance protein RUN1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g56510 TIR-NB-LRR receptor-like protein that confers broad-spectrum resistance and full immunity to several races of the pathogen Albugo candida (white rust disease).
WRR4 encodes a TIR-NB-LRR protein that confers broad-spectrum white rust resistance in Arabidopsis thaliana to four physiological races of Albugo candida.2008 · DOI: 10.1094/mpmi-21-6-0757
Activation tagging of ADR2 conveys a spreading lesion phenotype and resistance to biotrophic pathogens.2009 · DOI: 10.1111/j.1469-8137.2009.02902.x
Arabidopsis thaliana natural variation reveals connections between UV radiation stress and plant pathogen-like defense responses.2015 · DOI: 10.1016/j.plaphy.2015.01.011
At4g12010 TIR-NB-LRR receptor-like protein involved in plant defense.
Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.2017 · DOI: 10.1016/j.chom.2017.03.005
At4g19510 Disease resistance protein that cooperates with RPP2A to confer resistance to Hyaloperonospora parasitica isolate Cala2. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001291 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007165 signal transduction Biological Process
GO:0019677 NAD+ catabolic process Biological Process
GO:0043068 positive regulation of programmed cell death Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0003953 NAD+ nucleosidase activity Molecular Function
GO:0042803 protein homodimerization activity Molecular Function
GO:0043531 ADP binding Molecular Function
GO:0050135 NADP+ nucleosidase activity Molecular Function
GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function
KEGG gene cross-referenceNo functional description available
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.485
Rank 1 · TkA01G549570 · TK1151
Nucleus0.328
Rank 2 · TkA01G549570 · TK1151
Cell membrane0.265
Rank 3 · TkA01G549570 · TK1151
Endoplasmic reticulum0.087
Rank 4 · TkA01G549570 · TK1151
Extracellular0.036
Rank 5 · TkA01G549570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582TIR18-191 aa
PF13676TIR_220-116 aa
PF00931NB-ARC33-55 aa
PF08937ThsB_TIR48-97 aa
PF23952LRR_EndoS117-139 aa
PF13191AAA_16202-255 aa
PF00931NB-ARC207-380 aa
PF03215Rad17209-317 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G549570PF01582TIR181916.6e-35121.2
TkA01G549570PF13676TIR_2201161.2e-1558.8
TkA01G549570PF00931NB-ARC33557.2e-2072.0
TkA01G549570PF08937ThsB_TIR48970.1812.9
TkA01G549570PF23952LRR_EndoS1171390.006517.4
TkA01G549570PF13191AAA_162022550.0714.3
TkA01G549570PF00931NB-ARC2073807.2e-2072.0
TkA01G549570PF03215Rad172093170.04514.4
TkA01G549570PF24883NPHP3_N2112860.0003521.5
TkA01G549570PF25199nSTAND_NTPase52162740.113.1
TkA01G549570PF05729NACHT2253755.1e-0523.9
TkA01G549570PF20720nSTAND32253510.02614.9
TkA01G549570PF25199nSTAND_NTPase52853480.113.1
TkA01G549570PF23247LRR_RPS23584140.000520.8
TkA01G549570PF23282WHD_ROQ14525193.5e-1969.4
TkA01G549570PF12799LRR_45936084.8e-0833.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9C7X0Arabidopsis thalianasp|Q9C7X0|ADR2_ARATH Disease resistance protein ADR231.100%Swiss-ProtMedium
Q9SZ66Arabidopsis thalianasp|Q9SZ66|DSC1_ARATH Disease resistance-like protein DSC132.700%Swiss-ProtMedium
F4JT80Arabidopsis thalianasp|F4JT80|RPP2B_ARATH Disease resistance protein RPP2B33.000%Swiss-ProtMedium

JBrowse

View in Genome Browser