TkA01G549020 | RubberDandelionOmics

Gene overview

TkA01G549020

Reference: TK1151 Chr: Chr01 Coordinates: 137913622-137915447 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1727 bp · TkA01G549020|TK1151|cDNA

GTTCGGTGGTTTATTTGGAATTACAGATGGTAGACTGGTAGTTGAGTTCCTATTTACACCACCATACATATGCGCACTTTGTTCCGATAAAGTGATAAGTGTACTGAAAGTAAAAAAGCAGTTGATGCACAAGTGCTCTATGAACTATGTCGGATGTTCCGATGCCGCCGGATCTCCTCGCCCAAATCCTGGCATGGTTGCCGGTAGCCTCGCTTCTGCGATTCAGGTCTGTTTCGAAAACCTTTCGTGCCCTAATTGAT...

CDS

Download CDS FASTA

1173 bp · TkA01G549020|TK1151|CDS

ATGTCGGATGTTCCGATGCCGCCGGATCTCCTCGCCCAAATCCTGGCATGGTTGCCGGTAGCCTCGCTTCTGCGATTCAGGTCTGTTTCGAAAACCTTTCGTGCCCTAATTGATAGCGACTATGTGATTAAGCTCCATCTCAATCACTCAGTCGAAACCAACACCAATCTCAATATCATTTTCGGCGGCGATAGAACGCTTTGCTATCTTAACTTAGATTCGTCTCCCAAAGTTGTCAACAAAATAGATAACCCTCTGTA...

Protein

Download Protein FASTA

390 aa · TkA01G549020|TK1151|PROTEIN

MSDVPMPPDLLAQILAWLPVASLLRFRSVSKTFRALIDSDYVIKLHLNHSVETNTNLNIIFGGDRTLCYLNLDSSPKVVNKIDNPLYFAIFETIILGSCNGVVCLCTTEPDNEIAFWNPLVRKFKKIRLAPAKCAEGLGRGVCIKGFGYDGVNNDHKVVRLVQYCSLHNELAHSKIDVFSSKTDAWREVGDFPYYLCYRRNFNTFTKGALHWLVSRKPEKRLDFLICAFDLTNDELRIVPQPDFSNEKFHVNLAVLGGCL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G549020`
TK1151 ID	TkA01G549020
OH-1004 ID	LXL04_001298
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.500
Protein coverage (%)	TK1151 99.487 / OH-1004 93.229 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G549020

Location Chr01:137913622-137915447 (+)

Description Similar to CPR1: F-box protein CPR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12560`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	An F-box gene, CPR30, functions as a negative regulator of the defense response in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2009.03995.x
`At4g22390`	F-box protein At4g22390.	No verified direct reference in this release
`At3g06240`	F-box/kelch-repeat protein At3g06240.	No verified direct reference in this release
`At3g07870`	F-box protein At3g07870.	No verified direct reference in this release
`At5g07610`	F-box protein At5g07610.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001298 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G06240

ath:AT3G07870

ath:AT3G23880

ath:AT4G12560

ath:AT4G22390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.706

Rank 1 · TkA01G549020 · TK1151

Nucleus0.390

Rank 2 · TkA01G549020 · TK1151

Cell membrane0.073

Rank 3 · TkA01G549020 · TK1151

Endoplasmic reticulum0.064

Rank 4 · TkA01G549020 · TK1151

Lysosome / Vacuole0.030

Rank 5 · TkA01G549020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box6-42 aa

PF12937F-box-like7-41 aa

PF24981Beta-prop_ATRN-LZTR123-64 aa

PF00638Ran_BP130-75 aa

PF07734FBA_173-358 aa

PF24750b-prop_At3g26010-like90-298 aa

PF08268FBA_393-344 aa

PF12937F-box-like159-173 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G549020	`PF00646`	F-box	6	42	2.9e-10	40.3
TkA01G549020	`PF12937`	F-box-like	7	41	1.4e-06	28.6
TkA01G549020	`PF24981`	Beta-prop_ATRN-LZTR1	23	64	0.21	11.5
TkA01G549020	`PF00638`	Ran_BP1	30	75	0.12	13.4
TkA01G549020	`PF07734`	FBA_1	73	358	2e-27	96.8
TkA01G549020	`PF24750`	b-prop_At3g26010-like	90	298	4.4e-12	46.5
TkA01G549020	`PF08268`	FBA_3	93	344	2.2e-21	76.9
TkA01G549020	`PF12937`	F-box-like	159	173	1.4e-06	28.6
TkA01G549020	`PF24981`	Beta-prop_ATRN-LZTR1	321	370	0.21	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU30`	Arabidopsis thaliana	sp\|Q9SU30\|CPR1_ARATH F-box protein CPR1	32.200%	Swiss-Prot	Medium
`Q9SUY0`	Arabidopsis thaliana	sp\|Q9SUY0\|FB244_ARATH F-box protein At4g22390	31.800%	Swiss-Prot	Medium
`Q8GXC7`	Arabidopsis thaliana	sp\|Q8GXC7\|FBK50_ARATH F-box/kelch-repeat protein At3g06240	27.000%	Swiss-Prot	Low
`Q9SFC7`	Arabidopsis thaliana	sp\|Q9SFC7\|FB135_ARATH F-box protein At3g07870	26.500%	Swiss-Prot	Low
`Q9FLS0`	Arabidopsis thaliana	sp\|Q9FLS0\|FB253_ARATH F-box protein At5g07610	26.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card