RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G547690
Reference: TK1151 Chr: Chr01 Coordinates: 137550402-137555352 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3356 bp · TkA01G547690|TK1151|cDNA

AAAAATTCAACAGAAGTTTGGTAAACCAAGACGTCGAAAGGAGTGGGGGTTTAAAGAGGGCTTTAGGCCGAGCAAAGTCAAAATGTTAAATAGTATGGTTTCTTGTTCTTCAAGCTCGTCAATGGCGGTCCTTCACCCTGCCCAACATTCACATTAGTTTGAAAATTTTAACCAAGGAAAAGCTAAACGGCGACCTCTACAGCATTCCAATCTCATCATCATCGAATCACTCAAGTCCCCATGTTGAAGGCTTTGAGGTC...

CDS

Download CDS FASTA

2799 bp · TkA01G547690|TK1151|CDS

ATGTTGAAGGCTTTGAGGTCTTCTTCGTGCTTACAACAAGCTCGATTCCCCACAGGGACGTCGTATTTACAGTCTAGTTCACGCCATGGAACTAAACTGGCTTCACCGTTTCATGGAGTGTTGCGCTCTGTTATAGGGAATAAAAACCCTAAATTGTTTCAAAGAGTTTTCTTCTGTTCGGATGCGGGCGATGGATCTGGGTCCGGACCCGAGTCCGCTATTGAAGAAGCTGAGTCGAAATCTCCAGCAGCAATTGTTCC...

Protein

Download Protein FASTA

932 aa · TkA01G547690|TK1151|PROTEIN

MLKALRSSSCLQQARFPTGTSYLQSSSRHGTKLASPFHGVLRSVIGNKNPKLFQRVFFCSDAGDGSGSGPESAIEEAESKSPAAIVPTAIKKPDDFLTVLALPLPHRPLFPGFYMPIYVKDPKLLAALVESRKRQAPYAGAFLVKDDPGSEGTGADAEKNIYELKGKDLLNRLHEVGTLAQITSIQGDQVVLIGHRRLRITEMVSEDPLTVQVDHLKDSPYNKDDDVIKATSFEVITTLRDVLKTSSLWRDHVQTYNQHI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G547690
TK1151 IDTkA01G547690
OH-1004 IDLXL04_001322
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 99.679
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G547690
LocationChr01:137550402-137555352 (-)
DescriptionSimilar to LON2: Lon protease homolog, mitochondrial
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g26860 ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix.
Role of Lon1 protease in post-germinative growth and maintenance of mitochondrial function in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1469-8137.2008.02701.x
At3g05790 ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2YQ56 ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. No verified direct reference in this release
Os07g0689300 ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001322 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process
GO:0007005 mitochondrion organization Biological Process
GO:0034599 cellular response to oxidative stress Biological Process
GO:0051131 chaperone-mediated protein complex assembly Biological Process
GO:0070407 oxidation-dependent protein catabolic process Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0005759 mitochondrial matrix Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009535 chloroplast thylakoid membrane Cellular Component
GO:0003697 single-stranded DNA binding Molecular Function
GO:0004176 ATP-dependent peptidase activity Molecular Function
GO:0004252 serine-type endopeptidase activity Molecular Function
KEGG gene cross-reference
ath:AT3G05790
dosa:Os07g0689300
zma:732810
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.889
Rank 1 · TkA01G547690 · TK1151
Cytoplasm0.087
Rank 2 · TkA01G547690 · TK1151
Nucleus0.058
Rank 3 · TkA01G547690 · TK1151
Peroxisome0.033
Rank 4 · TkA01G547690 · TK1151
Cell membrane0.025
Rank 5 · TkA01G547690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02190LON_substr_bdg99-305 aa
PF05496RuvB_N235-275 aa
PF00005ABC_tran245-293 aa
PF13086AAA_11266-374 aa
PF13401AAA_22283-334 aa
PF20720nSTAND3298-326 aa
PF26688RHH_12303-360 aa
PF00931NB-ARC305-323 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G547690PF02190LON_substr_bdg993059.2e-38130.9
TkA01G547690PF05496RuvB_N2352753.1e-0524.5
TkA01G547690PF00005ABC_tran2452930.3912.0
TkA01G547690PF13086AAA_112663742.58.5
TkA01G547690PF13401AAA_222833347.5e-0523.8
TkA01G547690PF20720nSTAND32983260.002318.4
TkA01G547690PF26688RHH_123033601.79.9
TkA01G547690PF00931NB-ARC3053230.2811.4
TkA01G547690PF13207AAA_173083440.5211.3
TkA01G547690PF07726AAA_33103610.04314.4
TkA01G547690PF01202SKI3223780.1313.1
TkA01G547690PF24883NPHP3_N3273620.0215.8
TkA01G547690PF26688RHH_123753851.79.9
TkA01G547690PF08298AAA_PrkA4264810.001918.1
TkA01G547690PF05496RuvB_N4284873.1e-0524.5
TkA01G547690PF20030bpMoxR4374990.08812.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P93655Arabidopsis thalianasp|P93655|LONM1_ARATH Lon protease homolog 1, mitochondrial77.600%Swiss-ProtHigh
Q9M9L7Arabidopsis thalianasp|Q9M9L7|LONM4_ARATH Lon protease homolog 4, chloroplastic/mitochondrial74.700%Swiss-ProtHigh
A2YQ56Oryza sativa subsp. indicasp|A2YQ56|LONM_ORYSI Lon protease homolog, mitochondrial73.000%Swiss-ProtHigh
Q69UZ3Oryza sativa subsp. japonicasp|Q69UZ3|LONM_ORYSJ Lon protease homolog, mitochondrial72.900%Swiss-ProtHigh

JBrowse

View in Genome Browser