TkA01G546420 | RubberDandelionOmics

Gene overview

TkA01G546420

Reference: TK1151 Chr: Chr01 Coordinates: 137221659-137233096 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1667 bp · TkA01G546420|TK1151|cDNA

CGGAAGCTCACTTTGGCGGTCTCTGTCATTTATCATTTGTCCCATTTTTTTTGAACCCTGATACACCGTCGGTTCTTTTTTGTTACTCTAGATCGGTATCAAAAGGGCTATCGTTTTTTAAGGAATGGCGCTGATTATGCATTCAGAGTTAAACAAGAATGTCTGTAAGACATTAATTGCTGCAGATTATGTTGGTGTTGAAATCAAAATGGCTGAAAATTTTCAAATGGGCGAGTCAAACAAGACTCCCGAGTTTCTTA...

CDS

Download CDS FASTA

1269 bp · TkA01G546420|TK1151|CDS

ATGGCGCTGATTATGCATTCAGAGTTAAACAAGAATGTCTGTAAGACATTAATTGCTGCAGATTATGTTGGTGTTGAAATCAAAATGGCTGAAAATTTTCAAATGGGCGAGTCAAACAAGACTCCCGAGTTTCTTAAAATGAACCCTCTTGGAAAGGTTCCAGCTCTTGAAACCCCCGAGGGGCCTATATTTGAGAGTAATGCAATTGCTCGCTATGTTGCTCGTTTAAAGCCTGAAAATACTCTCTTCGGGTCTTCACC...

Protein

Download Protein FASTA

422 aa · TkA01G546420|TK1151|PROTEIN

MALIMHSELNKNVCKTLIAADYVGVEIKMAENFQMGESNKTPEFLKMNPLGKVPALETPEGPIFESNAIARYVARLKPENTLFGSSPIEYGQIEQWIDFSALELDANMRAWVFPRLGYATYIKSAEESYISGVKRGLGALNTHLQSRTFLVGYAVTLADIIMTCNLVNGFKYLFTKSFTSEFPHVERYFWTMVSQPKFSKIIKLMGEIKQAEVVLPFPSTSTSTKPKPEPKNEPVPNPKSKPVTEAFNDVEEAPKPKAKN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G546420`
TK1151 ID	TkA01G546420
OH-1004 ID	LXL04_016978
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	74.900
Protein coverage (%)	TK1151 95.735 / OH-1004 96.651 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G546420

Location Chr01:137221659-137233096 (-)

Description Similar to Elongation factor 1-gamma

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09640`	Probably plays a role in anchoring the complex to other cellular components.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0220500`	Probably plays a role in anchoring the complex to other cellular components.	No verified direct reference in this release
`Os02g0220600`	Probably plays a role in anchoring the complex to other cellular components.	No verified direct reference in this release
`Os06g0571400`	Probably plays a role in anchoring the complex to other cellular components.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016978 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010043 response to zinc ion Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0003746 translation elongation factor activity Molecular Function

GO:0004364 glutathione transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G09640

ath:AT1G57720

dosa:Os02g0220600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.738

Rank 1 · TkA01G546420 · TK1151

Nucleus0.189

Rank 2 · TkA01G546420 · TK1151

Endoplasmic reticulum0.115

Rank 3 · TkA01G546420 · TK1151

Cell membrane0.085

Rank 4 · TkA01G546420 · TK1151

Mitochondrion0.078

Rank 5 · TkA01G546420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18485GST_N_57-73 aa

PF02798GST_N12-75 aa

PF13409GST_N_215-75 aa

PF13417GST_N_316-80 aa

PF13410GST_C_2130-189 aa

PF14497GST_C_3131-198 aa

PF00043GST_C132-196 aa

PF21972Arc1p_N_like133-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G546420	`PF18485`	GST_N_5	7	73	0.096	13.9
TkA01G546420	`PF02798`	GST_N	12	75	4.6e-15	56.4
TkA01G546420	`PF13409`	GST_N_2	15	75	1.3e-08	36.0
TkA01G546420	`PF13417`	GST_N_3	16	80	1.1e-07	32.7
TkA01G546420	`PF13410`	GST_C_2	130	189	0.002	18.9
TkA01G546420	`PF14497`	GST_C_3	131	198	3.2e-05	24.8
TkA01G546420	`PF00043`	GST_C	132	196	4.9e-08	33.8
TkA01G546420	`PF21972`	Arc1p_N_like	133	189	0.00068	20.6
TkA01G546420	`PF00647`	EF1G	155	171	1.1e-43	148.1
TkA01G546420	`PF13409`	GST_N_2	241	266	1.3e-08	36.0
TkA01G546420	`PF00647`	EF1G	257	364	1.1e-43	148.1
TkA01G546420	`PF13410`	GST_C_2	327	337	0.002	18.9
TkA01G546420	`PF00647`	EF1G	377	403	1.1e-43	148.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04487`	Arabidopsis thaliana	sp\|O04487\|EF1G1_ARATH Probable elongation factor 1-gamma 1	70.000%	Swiss-Prot	High
`Q6YW46`	Oryza sativa subsp. japonica	sp\|Q6YW46\|EF1G2_ORYSJ Elongation factor 1-gamma 2	71.600%	Swiss-Prot	High
`Q9ZRI7`	Oryza sativa subsp. japonica	sp\|Q9ZRI7\|EF1G1_ORYSJ Elongation factor 1-gamma 1	71.200%	Swiss-Prot	High
`Q5Z627`	Oryza sativa subsp. japonica	sp\|Q5Z627\|EF1G3_ORYSJ Elongation factor 1-gamma 3	70.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card