TkA01G545410 | RubberDandelionOmics

Gene overview

TkA01G545410

Reference: TK1151 Chr: Chr01 Coordinates: 136881094-136881810 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

570 bp · TkA01G545410|TK1151|cDNA

ATGGAGGATTTCTACGAGACAAGAATCGAAGGTATCAACGGTGAACCAATCGGTCTTTTCGGAGTATTTGATGGCCATGGCGGTGCTCGAGCTGCAGAATACGTCAAACACAATCTCTTCACTAACCTAATCAAACACCCAAAGTTCATATCCGACACCAAATCCGCCATAGCCGAAGCATACAGCCACACAGACACAGAATTTTTAAAAACAGAAAACAATCAGATGAGAGATGCAGGATCAACAGCTTCCACCGCCAT...

CDS

Download CDS FASTA

570 bp · TkA01G545410|TK1151|CDS

ATGGAGGATTTCTACGAGACAAGAATCGAAGGTATCAACGGTGAACCAATCGGTCTTTTCGGAGTATTTGATGGCCATGGCGGTGCTCGAGCTGCAGAATACGTCAAACACAATCTCTTCACTAACCTAATCAAACACCCAAAGTTCATATCCGACACCAAATCCGCCATAGCCGAAGCATACAGCCACACAGACACAGAATTTTTAAAAACAGAAAACAATCAGATGAGAGATGCAGGATCAACAGCTTCCACCGCCAT...

Protein

Download Protein FASTA

189 aa · TkA01G545410|TK1151|PROTEIN

MEDFYETRIEGINGEPIGLFGVFDGHGGARAAEYVKHNLFTNLIKHPKFISDTKSAIAEAYSHTDTEFLKTENNQMRDAGSTASTAIIVAGTWRVGGVLAVSRAFGDRLLKQFVVADPEIQEEKIDEMLEFLILASYGLWDVITNEEAVAMIKPIQSPEVAAKTLMQEASRRGSADNITVVVVRFLDSH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G545410`
TK1151 ID	TkA01G545410
OH-1004 ID	LXL04_017010
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	66.000
Protein coverage (%)	TK1151 100.000 / OH-1004 81.229 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G545410

Location Chr01:136881094-136881810 (-)

Description Similar to WIN2: Probable protein phosphatase 2C 59

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31750`	Protein phosphatase that modulates defense response to pathogenic bacteria, conferring resistance and promoting salicylic acid (SA) accumulation.	Arabidopsis proteins important for modulating defense responses to Pseudomonas syringae that secrete HopW1-1.2008 · DOI: 10.1111/j.1365-313x.2008.03439.x
`At5g10740`	Probable protein phosphatase 2C 69.	No verified direct reference in this release
`At5g24940`	Probable protein phosphatase 2C 71.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0149800`	Probable protein phosphatase 2C 10.	No verified direct reference in this release
`Os06g0698300`	Probable protein phosphatase 2C 59.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017010 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G31750

ath:AT5G10740

ath:AT5G24940

dosa:Os02g0149800

dosa:Os06g0698300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.618

Rank 1 · TkA01G545410 · TK1151

Nucleus0.324

Rank 2 · TkA01G545410 · TK1151

Cell membrane0.134

Rank 3 · TkA01G545410 · TK1151

Mitochondrion0.077

Rank 4 · TkA01G545410 · TK1151

Lysosome / Vacuole0.074

Rank 5 · TkA01G545410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481PP2C16-89 aa

PF00481PP2C92-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G545410	`PF00481`	PP2C	16	89	1.3e-33	117.5
TkA01G545410	`PF00481`	PP2C	92	178	1.3e-33	117.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXV3`	Arabidopsis thaliana	sp\|Q8RXV3\|P2C59_ARATH Probable protein phosphatase 2C 59	63.700%	Swiss-Prot	High
`Q8LAY8`	Arabidopsis thaliana	sp\|Q8LAY8\|P2C69_ARATH Probable protein phosphatase 2C 69	62.700%	Swiss-Prot	High
`Q4PSE8`	Arabidopsis thaliana	sp\|Q4PSE8\|P2C71_ARATH Probable protein phosphatase 2C 71	62.000%	Swiss-Prot	High
`Q67UX7`	Oryza sativa subsp. japonica	sp\|Q67UX7\|P2C10_ORYSJ Probable protein phosphatase 2C 10	62.700%	Swiss-Prot	High
`Q5Z6F5`	Oryza sativa subsp. japonica	sp\|Q5Z6F5\|P2C59_ORYSJ Probable protein phosphatase 2C 59	61.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card