TkA01G544910 | RubberDandelionOmics

Gene overview

TkA01G544910

Reference: TK1151 Chr: Chr01 Coordinates: 136723936-136727567 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2107 bp · TkA01G544910|TK1151|cDNA

TGGGCATATCAGAAAATGATGGTTATCCACTTGACATTTTGTTTTATGAAAAAACTAATGAAACGTTATATTCTATAATTGTTTTCTTTTTGTATGAATTCTTTATTCAGGGCAGCAGACACGACAATTTCTTTATAACTTAATTTGTCATTACATACAAACCAGCCTCTCAAGTTTCTCTCGATATTTTCAATATCTCTAAACCATCTTCGTTCCAACCGGTATGGATGCTGGACCTTCCTCGTCCTCAGAGTTGCCGC...

CDS

Download CDS FASTA

663 bp · TkA01G544910|TK1151|CDS

ATGAGAATTTACTACGGTTGCTTGGATATTCCATTGAAGGAAGATATGTATCCCTTGTCTATGATTTTGCAGTTTTATGAAACTCTACTAGCCTCTATATTTGATCCTAAATATACTTTTTTGGACTGGAGTAAGCGCAACAAAATAATATTGGCTGTTGCTAGGGTACTTGTTTACCTTCACCAGCATCATGTCATCCACGGTAATGTCAATCCTGGAAAGATTCTTTTGGATGAATGTTTGCACCCCAAACTTTCACT...

Protein

Download Protein FASTA

220 aa · TkA01G544910|TK1151|PROTEIN

MRIYYGCLDIPLKEDMYPLSMILQFYETLLASIFDPKYTFLDWSKRNKIILAVARVLVYLHQHHVIHGNVNPGKILLDECLHPKLSLEITLNEFTFRNWQDTLLHHNTAPEVLHHGNQPTKIDVYSFGCLILETITGNRMGELKNLQDVWRNWLDGTCSNIKDPRIDADSSSITRIIHIGLLCIQKDAADRPTMEEVVSMLTNTSFLTLPTPKNAPEISR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G544910`
TK1151 ID	TkA01G544910
OH-1004 ID	LXL04_001341
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	64.500
Protein coverage (%)	TK1151 88.636 / OH-1004 29.940 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G544910

Location Chr01:136723936-136727567 (+)

Description Similar to ANX2: Receptor-like protein kinase ANXUR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21230`	Cysteine-rich receptor-like protein kinase 27.	No verified direct reference in this release
`At4g21410`	Cysteine-rich receptor-like protein kinase 29.	No verified direct reference in this release
`At4g23230`	Cysteine-rich receptor-like protein kinase 15.	No verified direct reference in this release
`At4g23320`	Cysteine-rich receptor-like protein kinase 24.	No verified direct reference in this release
`At4g23260`	Cysteine-rich receptor-like protein kinase 18.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001341 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010038 response to metal ion Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G28680

ath:AT5G38990

ath:AT5G39000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.532

Rank 1 · TkA01G544910 · TK1151

Cytoplasm0.323

Rank 2 · TkA01G544910 · TK1151

Nucleus0.219

Rank 3 · TkA01G544910 · TK1151

Endoplasmic reticulum0.055

Rank 4 · TkA01G544910 · TK1151

Golgi apparatus0.043

Rank 5 · TkA01G544910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase20-199 aa

PF07714PK_Tyr_Ser-Thr30-201 aa

PF06293Kdo43-79 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G544910	`PF00069`	Pkinase	20	199	9.5e-14	52.1
TkA01G544910	`PF07714`	PK_Tyr_Ser-Thr	30	201	2.1e-13	50.9
TkA01G544910	`PF06293`	Kdo	43	79	0.07	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49564`	Arabidopsis thaliana	sp\|O49564\|CRK27_ARATH Cysteine-rich receptor-like protein kinase 27	38.900%	Swiss-Prot	Medium
`Q8S9L6`	Arabidopsis thaliana	sp\|Q8S9L6\|CRK29_ARATH Cysteine-rich receptor-like protein kinase 29	41.200%	Swiss-Prot	Medium
`Q8W4G6`	Arabidopsis thaliana	sp\|Q8W4G6\|CRK15_ARATH Cysteine-rich receptor-like protein kinase 15	37.900%	Swiss-Prot	Medium
`O65483`	Arabidopsis thaliana	sp\|O65483\|CRK24_ARATH Cysteine-rich receptor-like protein kinase 24	39.000%	Swiss-Prot	Medium
`Q8RX80`	Arabidopsis thaliana	sp\|Q8RX80\|CRK18_ARATH Cysteine-rich receptor-like protein kinase 18	39.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card