TkA01G543710 | RubberDandelionOmics

Gene overview

TkA01G543710

Reference: TK1151 Chr: Chr01 Coordinates: 136378219-136379686 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1294 bp · TkA01G543710|TK1151|cDNA

GATGAACGTCGACCCCACTCTTGTCGAGATACTCCGGACTTTCCATAATCAAATATTCAGGGCACGTATAAAACCCTCCAATGGGGATCCTCAATTCTCCTCATCTTCAAATTCTAGAATCCAACTTCAATTCATACTCATTCCAATCTCAATCACAAAGAACATTAACAGATATATATTCGAATCACTGAAGGATGAGATCGCCGTCCAAATCCGTAACTAAAAGGGTCAGAGATGCCGAATCTGAGTTGAATTTGCCT...

CDS

Download CDS FASTA

900 bp · TkA01G543710|TK1151|CDS

ATGAGATCGCCGTCCAAATCCGTAACTAAAAGGGTCAGAGATGCCGAATCTGAGTTGAATTTGCCTCCGGGCTTCCGATTTCACCCAACGGACGAGGAGCTCATTGTTCACTATCTCTGTCGCAAGTCCCAAACGGCGGAGGTGATCACTGGCGTCGCTCCACCACCACCTATCATCGCCGATATTGATCTCTACAAGCACGATCCATGGGAGCTTCCTGATTTGGCTCTGTTTGGAACAAAGGAATGGTACTTCTTCAC...

Protein

Download Protein FASTA

299 aa · TkA01G543710|TK1151|PROTEIN

MRSPSKSVTKRVRDAESELNLPPGFRFHPTDEELIVHYLCRKSQTAEVITGVAPPPPIIADIDLYKHDPWELPDLALFGTKEWYFFTPRDRKYPNGSRPNRVTGNGYWKATGADKPIKRKSDSNRIVGIKKALVFYTGKGVKGIKTNWIMHEYRLPIPDTTTSKHSKLENWVLCRVYNKKNNPKEKIVPEDNNNRSIGDLIHPTSPFDESQTNNSDSMHSFENSDGEFGGNFEGDVMFLNDLPEESLTKVKGTSGQSTML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G543710`
TK1151 ID	TkA01G543710
OH-1004 ID	LXL04_004207
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G543710

Location Chr01:136378219-136379686 (+)

Description Similar to NAC068: NAC domain-containing protein 68

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08790`	Involved in disease resistance response.	The transcription factor ATAF2 represses the expression of pathogenesis-related genes in Arabidopsis.2005 · DOI: 10.1111/j.1365-313x.2005.02488.x Interaction of the Tobacco mosaic virus replicase protein with a NAC domain transcription factor is associated with the suppression of systemic host defenses.2009 · DOI: 10.1128/jvi.00941-09 ATAF2, a NAC transcription factor, binds to the promoter and regulates NIT2 gene expression involved in auxin biosynthesis.2012 · DOI: 10.1007/s10059-012-0122-2 ATAF2 integrates Arabidopsis brassinosteroid inactivation and seedling photomorphogenesis.2015 · DOI: 10.1242/dev.124347
`At1g77450`	Transcriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0816100`	Probable transcription factor involved in stress response.	No verified direct reference in this release
`Os03g0815100`	Transcription factor that possesses transactivation activity.	Overexpressing a NAM, ATAF, and CUC (NAC) transcription factor enhances drought resistance and salt tolerance in rice.2006 · DOI: 10.1073/pnas.0604882103 The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.2010 · DOI: 10.1007/s00438-010-0557-0
`Os07g0225300`	Probable transcription factor involved in stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004207 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010099 regulation of photomorphogenesis Biological Process

KEGG gene cross-reference

ath:AT1G01720

ath:AT5G08790

dosa:Os01g0816100

dosa:Os03g0815100

dosa:Os07g0225300

osa:4334553

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · TkA01G543710 · TK1151

Cytoplasm0.107

Rank 2 · TkA01G543710 · TK1151

Cell membrane0.043

Rank 3 · TkA01G543710 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA01G543710 · TK1151

Plastid0.015

Rank 5 · TkA01G543710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365NAM22-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G543710	`PF02365`	NAM	22	155	2.9e-47	160.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C598`	Arabidopsis thaliana	sp\|Q9C598\|NAC81_ARATH Protein ATAF2	58.700%	Swiss-Prot	Medium
`Q9CAR0`	Arabidopsis thaliana	sp\|Q9CAR0\|NAC32_ARATH NAC transcription factor 32	63.300%	Swiss-Prot	Medium
`Q52QH4`	Oryza sativa subsp. japonica	sp\|Q52QH4\|NAC68_ORYSJ NAC domain-containing protein 68	66.700%	Swiss-Prot	Medium
`Q75HE5`	Oryza sativa subsp. japonica	sp\|Q75HE5\|NAC2_ORYSJ NAC domain-containing protein 2	64.800%	Swiss-Prot	Medium
`Q7EZT1`	Oryza sativa subsp. japonica	sp\|Q7EZT1\|NAC67_ORYSJ NAC domain-containing protein 67	62.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card