TkA01G535510 | RubberDandelionOmics

Gene overview

TkA01G535510

Reference: TK1151 Chr: Chr01 Coordinates: 134390073-134392209 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1773 bp · TkA01G535510|TK1151|cDNA

GTTGGCTTAATCGTACGTTTCGTCATCCCACAACCCGATGAAGTCACCCCCGAAGCATGGCAATTGTTCTCCATATTTCTCTCCACCATATCCGGGCTCGTTTTATCGCCATTGCCAGTGGGCGCTTGGGCTTTTCTAGGCCTCACAACGACCGTCGTGACCAAAACCTTAACATTCTCAACGGCGTTTAGTGCTTTCAGCAATGAAGTGATCTGGTTGATTGTGATTTCGTTCTTTTTCGCTCGTGGGTTCGTTAAGAC...

CDS

Download CDS FASTA

1380 bp · TkA01G535510|TK1151|CDS

GTTGGCTTAATCGTACGTTTCGTCATCCCACAACCCGATGAAGTCACCCCCGAAGCATGGCAATTGTTCTCCATATTTCTCTCCACCATATCCGGGCTCGTTTTATCGCCATTGCCAGTGGGCGCTTGGGCTTTTCTAGGCCTCACAACGACCGTCGTGACCAAAACCTTAACATTCTCAACGGCGTTTAGTGCTTTCAGCAATGAAGTGATCTGGTTGATTGTGATTTCGTTCTTTTTCGCTCGTGGGTTCGTTAAGAC...

Protein

Download Protein FASTA

459 aa · TkA01G535510|TK1151|PROTEIN

VGLIVRFVIPQPDEVTPEAWQLFSIFLSTISGLVLSPLPVGAWAFLGLTTTVVTKTLTFSTAFSAFSNEVIWLIVISFFFARGFVKTGLGDRIATYFVKWLGKSTLGLSYGLTLSEVLIAPAMPSTTARAGGVFLPIIKSLSLSAGSKPNDPTSKKLGSYLIQSQFQCTSNSSALFLTAAAQNLLCLQLAEELGVVVADPWLSWFTAASVPALVSLLLTPYILYKIYPPETKDTPDAPAMAANKLDLMGPVTINEWVMIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G535510`
TK1151 ID	TkA01G535510
OH-1004 ID	LXL04_017148
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	86.500
Protein coverage (%)	TK1151 100.000 / OH-1004 69.651 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G535510

Location Chr01:134390073-134392209 (+)

Description Similar to DIT2-1: Dicarboxylate transporter 2.1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64290`	Glutamate/malate translocator involved with DIT1 in primary ammonia assimilation and in the re-assimilation of ammonia generated by the photorespiratory pathway.	The Arabidopsis mutant dct is deficient in the plastidic glutamate/malate translocator DiT2.2003 · DOI: 10.1046/j.1365-313x.2003.01806.x
`At5g64280`	May be involved in the transport of dicarboxylate compounds.	No verified direct reference in this release
`At5g12860`	2-oxoglutarate/malate translocator involved with DIT2-1 in primary ammonia assimilation and in the re-assimilation of ammonia generated by the photorespiratory pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017148 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0015729 oxaloacetate transport Biological Process

GO:0015742 alpha-ketoglutarate transport Biological Process

GO:0015743 malate transport Biological Process

GO:0015813 L-glutamate transmembrane transport Biological Process

GO:0019676 ammonia assimilation cycle Biological Process

GO:0071423 malate transmembrane transport Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009536 plastid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT5G12860

ath:AT5G64280

ath:AT5G64290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.326

Rank 1 · TkA01G535510 · TK1151

Endoplasmic reticulum0.259

Rank 2 · TkA01G535510 · TK1151

Lysosome / Vacuole0.177

Rank 3 · TkA01G535510 · TK1151

Cytoplasm0.101

Rank 4 · TkA01G535510 · TK1151

Golgi apparatus0.085

Rank 5 · TkA01G535510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00939Na_sulph_symp4-458 aa

PF03600CitMHS33-398 aa

PF03600CitMHS366-448 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G535510	`PF00939`	Na_sulph_symp	4	458	4e-137	458.8
TkA01G535510	`PF03600`	CitMHS	33	398	2.1e-16	60.7
TkA01G535510	`PF03600`	CitMHS	366	448	2.1e-16	60.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMF7`	Arabidopsis thaliana	sp\|Q9FMF7\|DIT21_ARATH Dicarboxylate transporter 2.1, chloroplastic	78.000%	Swiss-Prot	High
`Q9FMF8`	Arabidopsis thaliana	sp\|Q9FMF8\|DIT22_ARATH Dicarboxylate transporter 2.2, chloroplastic	71.000%	Swiss-Prot	High
`Q9LXV3`	Arabidopsis thaliana	sp\|Q9LXV3\|DIT1_ARATH Dicarboxylate transporter 1, chloroplastic	50.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card