TkA01G534370 | RubberDandelionOmics

Gene overview

TkA01G534370

Reference: TK1151 Chr: Chr01 Coordinates: 134112069-134112473 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · TkA01G534370|TK1151|cDNA

ATGTTGTTACACGAGAGGATTCTAGAAGAATCAAAGAAAATAGAAGGAAGAAAACCTTGCGGGCTTTTAAAGGAGATATACGGGATTGAAAAATCAGCTCGATTTATGAACGAATTGACTGATTTCATTCAGTTCCCTTCACATGAAGAAAAGGAAGAAGACGTTAGAAAAAGAGTGATTCGGCTTCGGTTCGATATGGTTTGGTTCAGCGGTCCGGCTTCGGTTAAATATGGTCCGGTTCGGCGGTCCGGCTTCGGTTT...

CDS

Download CDS FASTA

405 bp · TkA01G534370|TK1151|CDS

ATGTTGTTACACGAGAGGATTCTAGAAGAATCAAAGAAAATAGAAGGAAGAAAACCTTGCGGGCTTTTAAAGGAGATATACGGGATTGAAAAATCAGCTCGATTTATGAACGAATTGACTGATTTCATTCAGTTCCCTTCACATGAAGAAAAGGAAGAAGACGTTAGAAAAAGAGTGATTCGGCTTCGGTTCGATATGGTTTGGTTCAGCGGTCCGGCTTCGGTTAAATATGGTCCGGTTCGGCGGTCCGGCTTCGGTTT...

Protein

Download Protein FASTA

134 aa · TkA01G534370|TK1151|PROTEIN

MLLHERILEESKKIEGRKPCGLLKEIYGIEKSARFMNELTDFIQFPSHEEKEEDVRKRVIRLRFDMVWFSGPASVKYGPVRRSGFGLTWFGSAWSGIGLTWSGFGLTWFGSAVRLRFDMVRFGLTVSGFGFGMA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G534370`
TK1151 ID	TkA01G534370
OH-1004 ID	LXL04_031231
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	84.100
Protein coverage (%)	TK1151 47.015 / OH-1004 16.279 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G534370`
Location	Chr01:134112069-134112473 (+)
Description	Similar to ROH1: Protein ROH1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_031231` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006887 exocytosis Biological Process GO:0006904 vesicle docking involved in exocytosis Biological Process GO:0009409 response to cold Biological Process GO:0009555 pollen development Biological Process GO:0009631 cold acclimation Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009741 response to brassinosteroid Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0010214 seed coat development Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0019428 allantoin biosynthetic process Biological Process GO:0040008 regulation of growth Biological Process
KEGG gene cross-reference	ath:AT1G18740 ath:AT1G63930 ath:AT1G74450 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.490

Rank 1 · TkA01G534370 · TK1151

Cytoplasm0.423

Rank 2 · TkA01G534370 · TK1151

Mitochondrion0.085

Rank 3 · TkA01G534370 · TK1151

Cell membrane0.071

Rank 4 · TkA01G534370 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA01G534370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05633ROH1-like1-61 aa

PF06260DUF102415-60 aa

PF05757PsbQ24-66 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G534370	`PF05633`	ROH1-like	1	61	6.8e-14	52.4
TkA01G534370	`PF06260`	DUF1024	15	60	0.12	13.4
TkA01G534370	`PF05757`	PsbQ	24	66	0.045	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card