TkA01G533390 | RubberDandelionOmics

Gene overview

TkA01G533390

Reference: TK1151 Chr: Chr01 Coordinates: 133877488-133882213 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3118 bp · TkA01G533390|TK1151|cDNA

TTTTGATCGAAAGACTCTCATTCGTTTTCATATTTTCACACTAAAATTAGTTTTCTTTTGAATATTTAATGAAATGAAAACAAAATGACATCGGCTTCAGCTCGTCTTCTAGACTCCCCGATCTAGGTCTATTCGTCGTCCGGTGGGCAGTAATCATCAAGAAAACTCATCCGAGATTCGTCTATCTGAAATTTTTTGAGGCAAACCCTAGATAGTTTCCCCTAAACCCCTTTGTTGATTATCCAGTAATTGATATAAAG...

CDS

Download CDS FASTA

2445 bp · TkA01G533390|TK1151|CDS

ATGGATGACTATGAAATCGTTTCAGATCCTCCACAAATGCTTCCACCTCCACCTGGCAGTTTCCTAGACCGTGAAGAACTCATCCAACATGTTGGTGAGTTTGGTGTCTCTCAGGGATACGTTGTAACCATCAAGCAATCCAAGAAGGAGAAAGTTGTGGTTCTTGGATGCCAAAGAGGAGGTGTTTACAGAAACAGGCGGAAAGGAATCGATGATGGAAGTGGTGAACTTGTCCGCAAAAGAAAGTCTGGTTCCCGCCT...

Protein

Download Protein FASTA

814 aa · TkA01G533390|TK1151|PROTEIN

MDDYEIVSDPPQMLPPPPGSFLDREELIQHVGEFGVSQGYVVTIKQSKKEKVVVLGCQRGGVYRNRRKGIDDGSGELVRKRKSGSRLTNCPFELVGKKDDGFWVLSVKNGSHNHEPLSDITQHPSARRFTEDEVLLIKEMTEAGLKPRQILKRLRQHNPELLSTPKHVYNIKTKLRQGNLTVRRYKTLRPHSSAQGNSNSSTTSEPSWRQRYPPRVPNFIGGMFIDSQSRTSIDVINPATQQVVSQVPLTTGEEFRAAVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G533390`
TK1151 ID	TkA01G533390
OH-1004 ID	LXL04_001468
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 97.381 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G533390

Location Chr01:133877488-133882213 (+)

Description Similar to ALDH6B2: Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g14170`	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001468 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006210 thymine catabolic process Biological Process

GO:0006573 valine metabolic process Biological Process

GO:0006574 L-valine catabolic process Biological Process

GO:0009083 branched-chain amino acid catabolic process Biological Process

GO:0019484 beta-alanine catabolic process Biological Process

GO:0019859 thymine metabolic process Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G14170

ddi:DDB_G0289085

hsa:4329

mmu:104776

rno:81708

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.457

Rank 1 · TkA01G533390 · TK1151

Nucleus0.271

Rank 2 · TkA01G533390 · TK1151

Peroxisome0.148

Rank 3 · TkA01G533390 · TK1151

Mitochondrion0.116

Rank 4 · TkA01G533390 · TK1151

Plastid0.099

Rank 5 · TkA01G533390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08731AFT23-115 aa

PF03101FAR134-115 aa

PF00171Aldedh224-688 aa

PF05893LuxC338-401 aa

PF03101FAR1749-754 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G533390	`PF08731`	AFT	23	115	0.088	13.8
TkA01G533390	`PF03101`	FAR1	34	115	0.11	13.9
TkA01G533390	`PF00171`	Aldedh	224	688	2.7e-130	435.7
TkA01G533390	`PF05893`	LuxC	338	401	0.039	13.5
TkA01G533390	`PF03101`	FAR1	749	754	0.11	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WM29`	Arabidopsis thaliana	sp\|Q0WM29\|MMSA_ARATH Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial	68.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card