TkA01G532020 | RubberDandelionOmics

Gene overview

TkA01G532020

Reference: TK1151 Chr: Chr01 Coordinates: 133526712-133528210 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1129 bp · TkA01G532020|TK1151|cDNA

TTTCCAGCCAGTTGTGGTCTTGCAGAATAACAATCAAATATTTGCCTATATATATTCACACTCTCGTTACTTAATATTGGCAAAACCTTCTCTCCACGTTTTGGGTCTATTTTCTCCCTTAATTGGAATTCTAACTGAAATTCGAAAAGAGGATTTGGTAAATGGGAGAAATGGGAGAAACGGAGGTGGTGCTGTTGGGATGGCAGCTAAGCATGTTTAGTGCAAAGGTCAGAATCTCTATGGAAGAAAAGGGCATCAAG...

CDS

Download CDS FASTA

471 bp · TkA01G532020|TK1151|CDS

ATGGGAGAAATGGGAGAAACGGAGGTGGTGCTGTTGGGATGGCAGCTAAGCATGTTTAGTGCAAAGGTCAGAATCTCTATGGAAGAAAAGGGCATCAAGTATGAGTACAAAGAAGAAGACTTACCACTCAACAAAAGCCCTCTTCTTCTCAAACTTAATCCAATTCATAAAAAAGTCCCGGTTTTGATTCACAACGGAAGACCCGTGTGTGAATCCAAAATCATCATTGAGTACATTGATGAGGCATGGAAGGATGAATC...

Protein

Download Protein FASTA

156 aa · TkA01G532020|TK1151|PROTEIN

MGEMGETEVVLLGWQLSMFSAKVRISMEEKGIKYEYKEEDLPLNKSPLLLKLNPIHKKVPVLIHNGRPVCESKIIIEYIDEAWKDESPLLPSDPYLRSQSRFWVDYTDKIYEFGIKLIKGSKGEEMEKASQELLGCLKVLEEEIGEKSFFMGTTGW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G532020`
TK1151 ID	TkA01G532020
OH-1004 ID	LXL04_001490
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	84.900
Protein coverage (%)	TK1151 97.436 / OH-1004 67.556 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G532020

Location Chr01:133526712-133528210 (+)

Description Similar to Probable glutathione S-transferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17180`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release
`At1g78340`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release
`At1g78320`	May be involved in the conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles and have a detoxification role against certain herbicides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001490 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006749 glutathione metabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009407 toxin catabolic process Biological Process

GO:0009629 response to gravity Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0046256 2,4,6-trinitrotoluene catabolic process Biological Process

GO:2000030 regulation of response to red or far red light Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G17180

ath:AT1G78370

ath:AT1G78380

nta:107782951

nta:107823949

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.782

Rank 1 · TkA01G532020 · TK1151

Nucleus0.244

Rank 2 · TkA01G532020 · TK1151

Mitochondrion0.089

Rank 3 · TkA01G532020 · TK1151

Cell membrane0.063

Rank 4 · TkA01G532020 · TK1151

Endoplasmic reticulum0.060

Rank 5 · TkA01G532020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02798GST_N10-81 aa

PF13417GST_N_311-82 aa

PF13409GST_N_217-81 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G532020	`PF02798`	GST_N	10	81	4.9e-18	65.9
TkA01G532020	`PF13417`	GST_N_3	11	82	8e-16	58.8
TkA01G532020	`PF13409`	GST_N_2	17	81	4.4e-15	56.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHH7`	Arabidopsis thaliana	sp\|Q9SHH7\|GSTUP_ARATH Glutathione S-transferase U25	55.800%	Swiss-Prot	High
`Q8GYM1`	Arabidopsis thaliana	sp\|Q8GYM1\|GSTUM_ARATH Glutathione S-transferase U22	54.100%	Swiss-Prot	High
`Q9M9F1`	Arabidopsis thaliana	sp\|Q9M9F1\|GSTUN_ARATH Glutathione S-transferase U23	53.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card