TkA01G528100 | RubberDandelionOmics

Gene overview

TkA01G528100

Reference: TK1151 Chr: Chr01 Coordinates: 132548681-132549720 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

772 bp · TkA01G528100|TK1151|cDNA

CATATATGAGACAATAATGATAACTAGTGGGAAGCAAAGCAACTTAATAAGATGACGACACAAAAAATGTCACATCACAACACTAACTTAAAAAGTTAAAATAATAGTATTTGTGTGTGAGTGAGTGGGTGAGAGAGAGAGAGAGTATTGAAATAGCTTGTTTCCCATGTAGTAATATAATTCCTCCATGATCTAAGTCTAAGGTCTACTACTACTACTTACTTACTTACTCTACACATATCTTTATCTCTCTAAAAAAA...

CDS

Download CDS FASTA

429 bp · TkA01G528100|TK1151|CDS

ATGAATCCCACAAACGAAGAAAAGAGTTGGCTGAATCTAGGCCAAACATTTCAAGACTCGTGTTCAAGGTCAGATTCGAATACAAAGCCTATAAGTGTGAAGGTGTGTCACTTTTGCAAGAGGAAGTTCTACAGTCCGCAAGCACTTGGTGGGCACCAAAATGCGCACAAGAGAGAGAGGGATGCTGCTAGAAGATACAACTCGCTCACCATGCAAAACAAGTTCCCAGTTCATCGAACACTTGGTGTGCATCCCCACTC...

Protein

Download Protein FASTA

142 aa · TkA01G528100|TK1151|PROTEIN

MNPTNEEKSWLNLGQTFQDSCSRSDSNTKPISVKVCHFCKRKFYSPQALGGHQNAHKRERDAARRYNSLTMQNKFPVHRTLGVHPHSFPLKPSGNEGTGVTVGGEYGGRCEEGVGMGLMWPGSFFMDSQPSDHLALDLTLKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G528100`
TK1151 ID	TkA01G528100
OH-1004 ID	LXL04_001534
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G528100

Location Chr01:132548681-132549720 (-)

Description Similar to ZFP3: Zinc finger protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25160`	Acts as a negative regulator of abscisic acid (ABA) signaling during germination and early seedling development.	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At1g24625`	Acts as a negative regulator of abscisic acid (ABA) signaling during germination and early seedling development.	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294
`At5g48890`	Acts as a transcriptional repressor.	LATE, a C(2)H(2) zinc-finger protein that acts as floral repressor.2011 · DOI: 10.1111/j.1365-313x.2011.04717.x
`At1g80730`	May play a role in the regulation of shoot development, downstream of photomorphogenic activation (Probable).	The Arabidopsis ZINC FINGER PROTEIN3 Interferes with Abscisic Acid and Light Signaling in Seed Germination and Plant Development.2014 · DOI: 10.1104/pp.113.234294 Expression analysis of an Arabidopsis C2H2 zinc finger protein gene.1996 · DOI: 10.1007/bf00020477
`At5g14010`	May function as a transcriptional repressor of cellular proliferation that regulates floral determinacy and relative size of basal pattern elements along the proximo-distal axis of the developing gynoecium.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001534 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010582 floral meristem determinacy Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0030154 cell differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G24625

ath:AT1G66140

ath:AT1G80730

ath:AT5G14010

ath:AT5G25160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.975

Rank 1 · TkA01G528100 · TK1151

Cytoplasm0.086

Rank 2 · TkA01G528100 · TK1151

Cell membrane0.023

Rank 3 · TkA01G528100 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA01G528100 · TK1151

Plastid0.009

Rank 5 · TkA01G528100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13912zf-C2H2_635-58 aa

PF13894zf-C2H2_435-56 aa

PF00096zf-C2H235-56 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G528100	`PF13912`	zf-C2H2_6	35	58	0.0014	19.3
TkA01G528100	`PF13894`	zf-C2H2_4	35	56	0.012	17.0
TkA01G528100	`PF00096`	zf-C2H2	35	56	0.11	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39262`	Arabidopsis thaliana	sp\|Q39262\|ZFP3_ARATH Zinc finger protein 3	37.400%	Swiss-Prot	Medium
`Q39266`	Arabidopsis thaliana	sp\|Q39266\|ZFP7_ARATH Zinc finger protein 7	43.500%	Swiss-Prot	Medium
`Q9FKA9`	Arabidopsis thaliana	sp\|Q9FKA9\|LATE_ARATH Protein LATE FLOWERING	61.400%	Swiss-Prot	Low
`Q42485`	Arabidopsis thaliana	sp\|Q42485\|ZFP1_ARATH Zinc finger protein 1	36.100%	Swiss-Prot	Medium
`Q9FFX4`	Arabidopsis thaliana	sp\|Q9FFX4\|KNU_ARATH Zinc finger protein KNUCKLES	55.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card