Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1134 bp · TkA01G524300|TK1151|cDNA
ATGACCACCATCTTTCTATTCCTCTACCTCCTCCTCATATCCACCGCCACTGCCACCACCCTCTATTCCGATGTCTCCGCCCTCAAAGCCATAAAGGCCGCCATCGATCCCACCACCATCCCTTCTTACTCTTGCTTAGCCTCCTGGAATTTCACCTCCGATCCTTGCTCCAACCATCACGTCACTCACTTCCTCTGCGGCCTCTCCTGCTCCGGCAACCGAGTCACCCAACTCACCTTCGATCGCGCAGGTTACGTCGG...
1134 bp · TkA01G524300|TK1151|CDS
ATGACCACCATCTTTCTATTCCTCTACCTCCTCCTCATATCCACCGCCACTGCCACCACCCTCTATTCCGATGTCTCCGCCCTCAAAGCCATAAAGGCCGCCATCGATCCCACCACCATCCCTTCTTACTCTTGCTTAGCCTCCTGGAATTTCACCTCCGATCCTTGCTCCAACCATCACGTCACTCACTTCCTCTGCGGCCTCTCCTGCTCCGGCAACCGAGTCACCCAACTCACCTTCGATCGCGCAGGTTACGTCGG...
Protein
Download Protein FASTA377 aa · TkA01G524300|TK1151|PROTEIN
MTTIFLFLYLLLISTATATTLYSDVSALKAIKAAIDPTTIPSYSCLASWNFTSDPCSNHHVTHFLCGLSCSGNRVTQLTFDRAGYVGTLSPLVSKLTQLITIDISDNKLSGPIPASLFSLPNLQTLNLRSNSFSGTIPPAISNLKSIQAIEISHNSLSGSLPDTLSLLTLTRLDLSFNKFTGPIPKLPKTLIELAVKSNSLSGYLPKTSFNGLTQLEVVELSDNSLTGTIPGWFLLQQSLQQVNLANNGFTGIEISKPID...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G524300 |
|---|---|
| TK1151 ID | TkA01G524300 |
| OH-1004 ID | LXL04_001581 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 94.960 / OH-1004 94.459Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G524300 |
|---|---|
| Location | Chr01:131625007-131626140 (+) |
| Description | Similar to GSO1: LRR receptor-like serine/threonine-protein kinase GSO1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009611 response to wounding Biological Process GO:0042659 regulation of cell fate specification Biological Process GO:0045184 establishment of protein localization Biological Process GO:0051302 regulation of cell division Biological Process GO:0055075 potassium ion homeostasis Biological Process GO:0090708 specification of plant organ axis polarity Biological Process GO:0160073 Casparian strip assembly Biological Process GO:2000067 regulation of root morphogenesis Biological Process GO:2000280 regulation of root development Biological Process GO:0005886 plasma membrane Cellular Component GO:0048226 Casparian strip Cellular Component GO:0004674 protein serine/threonine kinase activity Molecular Function |
| KEGG gene cross-reference | ath:AT4G20140 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13516LRR_657-63 aaPF00560LRR_168-77 aaPF12799LRR_468-109 aaPF25013LRR_Zer-179-111 aaPF25019LRR_R13L1-DRL2183-129 aaPF23598LRR_1487-189 aaPF13855LRR_895-132 aaPF24141LRR_ComC97-186 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G524300 | PF13516 | LRR_6 | 57 | 63 | 0.019 | 15.7 |
| TkA01G524300 | PF00560 | LRR_1 | 68 | 77 | 2e-26 | 87.1 |
| TkA01G524300 | PF12799 | LRR_4 | 68 | 109 | 1.6e-14 | 54.3 |
| TkA01G524300 | PF25013 | LRR_Zer-1 | 79 | 111 | 0.17 | 12.8 |
| TkA01G524300 | PF25019 | LRR_R13L1-DRL21 | 83 | 129 | 0.45 | 11.1 |
| TkA01G524300 | PF23598 | LRR_14 | 87 | 189 | 0.00014 | 21.5 |
| TkA01G524300 | PF13855 | LRR_8 | 95 | 132 | 1.2e-22 | 80.1 |
| TkA01G524300 | PF24141 | LRR_ComC | 97 | 186 | 0.00034 | 21.1 |
| TkA01G524300 | PF24758 | LRR_At5g56370 | 97 | 158 | 0.12 | 12.8 |
| TkA01G524300 | PF00560 | LRR_1 | 99 | 120 | 2e-26 | 87.1 |
| TkA01G524300 | PF13516 | LRR_6 | 99 | 111 | 0.019 | 15.7 |
| TkA01G524300 | PF12799 | LRR_4 | 121 | 159 | 1.6e-14 | 54.3 |
| TkA01G524300 | PF13516 | LRR_6 | 121 | 134 | 0.019 | 15.7 |
| TkA01G524300 | PF00560 | LRR_1 | 122 | 144 | 2e-26 | 87.1 |
| TkA01G524300 | PF25019 | LRR_R13L1-DRL21 | 136 | 175 | 0.45 | 11.1 |
| TkA01G524300 | PF13855 | LRR_8 | 140 | 180 | 1.2e-22 | 80.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.