TkA01G519850 | RubberDandelionOmics

Gene overview

TkA01G519850

Reference: TK1151 Chr: Chr01 Coordinates: 130316724-130317482 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

759 bp · TkA01G519850|TK1151|cDNA

ATGGCTGCTACTTCTTCCGACCACCCATCGGAGCTCACCTTGCGAGAAATACCCGGCAGCTATGGCCTCCCGTTCTTCGGACCAATCAAGGACCGTTACGACTACTTTTACAACCAAGGCCAAGACGAGTTCTTCAAAACCAGAATTCAGAAGTACAACTCCACCGTATTCCGCACCAACATGCCGCCGGGGCCGTTCATCTCCTCCAATCCGAAAGTCGTCGCCGTCCTTGATTCCAAAAGCTTCACCATCCTCTTCGA...

CDS

Download CDS FASTA

759 bp · TkA01G519850|TK1151|CDS

ATGGCTGCTACTTCTTCCGACCACCCATCGGAGCTCACCTTGCGAGAAATACCCGGCAGCTATGGCCTCCCGTTCTTCGGACCAATCAAGGACCGTTACGACTACTTTTACAACCAAGGCCAAGACGAGTTCTTCAAAACCAGAATTCAGAAGTACAACTCCACCGTATTCCGCACCAACATGCCGCCGGGGCCGTTCATCTCCTCCAATCCGAAAGTCGTCGCCGTCCTTGATTCCAAAAGCTTCACCATCCTCTTCGA...

Protein

Download Protein FASTA

252 aa · TkA01G519850|TK1151|PROTEIN

MAATSSDHPSELTLREIPGSYGLPFFGPIKDRYDYFYNQGQDEFFKTRIQKYNSTVFRTNMPPGPFISSNPKVVAVLDSKSFTILFDNDKVEKKNILDGTFMPSTSFFGGYRVCAFLDTTESNHHALKSLFISFLASSHKKFIPYLRTGLTELFGNLENEIAEKKSADFNTHSDNMAFDFVFRLVTGVLPSETEIKSKGPVTVTTWLALQLAPLGTSGSKFVPNFLDDIIHTVRLPFFCDQIWIQEALQCRL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G519850`
TK1151 ID	TkA01G519850
OH-1004 ID	LXL04_001673
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.444 / OH-1004 49.791 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G519850

Location Chr01:130316724-130317482 (-)

Description Similar to AOS3: Allene oxide synthase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42650`	Cytochrome P450 enzyme involved in the biosynthesis of oxylipin jasmonates, important phytohormones acting as growth regulators and signaling molecules for plant defense.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001673 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006952 defense response Biological Process

GO:0009695 jasmonic acid biosynthetic process Biological Process

GO:0016125 sterol metabolic process Biological Process

GO:0031408 oxylipin biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0009978 allene oxide synthase activity Molecular Function

KEGG gene cross-reference

sly:101247264

sly:101266902

sly:606711

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.347

Rank 1 · TkA01G519850 · TK1151

Mitochondrion0.253

Rank 2 · TkA01G519850 · TK1151

Cytoplasm0.095

Rank 3 · TkA01G519850 · TK1151

Plastid0.094

Rank 4 · TkA01G519850 · TK1151

Extracellular0.042

Rank 5 · TkA01G519850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96242`	Arabidopsis thaliana	sp\|Q96242\|CP74A_ARATH Allene oxide synthase, chloroplastic	50.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card