TkA01G519210 | RubberDandelionOmics

Gene overview

TkA01G519210

Reference: TK1151 Chr: Chr01 Coordinates: 130154895-130155227 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

333 bp · TkA01G519210|TK1151|cDNA

ATGGAGTCCTACACAAAGCTAGCCATTGTATCCATAATTCTAGTGACAACTCTTGTGACTGAACCCATGGCTACAAATGGTCTTCTCATATGTGGGATAAACATCGATGACCTAAAGACCTGCCAACCTGCAGTGACAAAAGATGTGAACCCTCTTCCACCACCAACACCTGATTGTTGTGCTTCCCTAAGTCCCCTAACCGGAGATAATATGCCATGTTTCTGCAACTTAGTGGACTCAAGTTTGTTGAATATTTACAA...

CDS

Download CDS FASTA

333 bp · TkA01G519210|TK1151|CDS

ATGGAGTCCTACACAAAGCTAGCCATTGTATCCATAATTCTAGTGACAACTCTTGTGACTGAACCCATGGCTACAAATGGTCTTCTCATATGTGGGATAAACATCGATGACCTAAAGACCTGCCAACCTGCAGTGACAAAAGATGTGAACCCTCTTCCACCACCAACACCTGATTGTTGTGCTTCCCTAAGTCCCCTAACCGGAGATAATATGCCATGTTTCTGCAACTTAGTGGACTCAAGTTTGTTGAATATTTACAA...

Protein

Download Protein FASTA

110 aa · TkA01G519210|TK1151|PROTEIN

MESYTKLAIVSIILVTTLVTEPMATNGLLICGINIDDLKTCQPAVTKDVNPLPPPTPDCCASLSPLTGDNMPCFCNLVDSSLLNIYKIDPILAMELPRKCDLPQANYYHC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G519210`
TK1151 ID	TkA01G519210
OH-1004 ID	LXL04_001682
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 98.182 / OH-1004 95.575 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G519210`
Location	Chr01:130154895-130155227 (-)
Description	Similar to DIR1: Putative lipid-transfer protein DIR1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001682` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006869 lipid transport Biological Process GO:0009627 systemic acquired resistance Biological Process GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process GO:0005576 extracellular region Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0009506 plasmodesma Cellular Component GO:0048046 apoplast Cellular Component GO:0099503 secretory vesicle Cellular Component GO:0005504 fatty acid binding Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	ath:AT5G48485 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.351

Rank 1 · TkA01G519210 · TK1151

Cell membrane0.272

Rank 2 · TkA01G519210 · TK1151

Endoplasmic reticulum0.147

Rank 3 · TkA01G519210 · TK1151

Cytoplasm0.122

Rank 4 · TkA01G519210 · TK1151

Lysosome / Vacuole0.077

Rank 5 · TkA01G519210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14368LTP_216-110 aa

PF00234Tryp_alpha_amyl31-110 aa

PF14547Hydrophob_seed54-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G519210	`PF14368`	LTP_2	16	110	4e-14	53.2
TkA01G519210	`PF00234`	Tryp_alpha_amyl	31	110	5.1e-11	43.4
TkA01G519210	`PF14547`	Hydrophob_seed	54	101	0.079	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card