TkA01G516800 | RubberDandelionOmics

Gene overview

TkA01G516800

Reference: TK1151 Chr: Chr01 Coordinates: 129568752-129571054 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1136 bp · TkA01G516800|TK1151|cDNA

TTTCAATAATGATTCTATATATACATACTTTGGCTCTCATGAATTAAAAAACAGGAGACAAATGGGAAATGTCTTTGCCGTGATGACCGCTCTTCTTCACGGAGTCGTAAAGCTCGCCGGATTAACACCACAAACCATAGAAATAGAGCCGGGGACCATTATGAAAGTATGGGTTCCAAAAGAAACCGTCACCAAAAATGACGGGAAAACCGTTTACATACCACCGACGAAGCCCGCGGTGCTACTCCTCCACTCTTTCT...

CDS

Download CDS FASTA

924 bp · TkA01G516800|TK1151|CDS

ATGGGAAATGTCTTTGCCGTGATGACCGCTCTTCTTCACGGAGTCGTAAAGCTCGCCGGATTAACACCACAAACCATAGAAATAGAGCCGGGGACCATTATGAAAGTATGGGTTCCAAAAGAAACCGTCACCAAAAATGACGGGAAAACCGTTTACATACCACCGACGAAGCCCGCGGTGCTACTCCTCCACTCTTTCTCCATGGACGGCATTTTCAACTGGTTTTTTCAAGTCTTGACGTTGACCCGAGAATACTCGGT...

Protein

Download Protein FASTA

307 aa · TkA01G516800|TK1151|PROTEIN

MGNVFAVMTALLHGVVKLAGLTPQTIEIEPGTIMKVWVPKETVTKNDGKTVYIPPTKPAVLLLHSFSMDGIFNWFFQVLTLTREYSVYVPDFLFFGGSITDRKERSVSFQAEFVAKGLEKLRVEKVILVGLSYGGIVGFKMAKLYPELVKSMVVSCTVIELTESISRDVYKQLGVSSWSELLMPTTIEGLKRLTSVVAHKPLWAPDFIYRNILETTFGNRKERIELLEALVVPDDDANSDFNYSQTIHMLWGEDDKIFDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G516800`
TK1151 ID	TkA01G516800
OH-1004 ID	LXL04_001710
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 99.674 / OH-1004 99.029 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G516800`
Location	Chr01:129568752-129571054 (-)
Description	Similar to yugF: Uncharacterized hydrolase YugF (Bacillus subtilis (strain 168)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001710` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0046464 acylglycerol catabolic process Biological Process GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0004301 epoxide hydrolase activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0047372 monoacylglycerol lipase activity Molecular Function GO:0052689 carboxylic ester hydrolase activity Molecular Function
KEGG gene cross-reference	bsu:BSU31420 mbo:BQ2027_MB2734 mmu:384214 mtc:MT2788 mtu:Rv2715 mtv:RVBD_2715 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.480

Rank 1 · TkA01G516800 · TK1151

Cytoplasm0.186

Rank 2 · TkA01G516800 · TK1151

Lysosome / Vacuole0.169

Rank 3 · TkA01G516800 · TK1151

Cell membrane0.128

Rank 4 · TkA01G516800 · TK1151

Golgi apparatus0.107

Rank 5 · TkA01G516800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00561Abhydrolase_158-173 aa

PF12697Abhydrolase_660-289 aa

PF12146Hydrolase_4112-289 aa

PF05577Peptidase_S28117-159 aa

PF01738DLH119-152 aa

PF07819PGAP1121-156 aa

PF02230Abhydrolase_2121-159 aa

PF00326Peptidase_S9122-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G516800	`PF00561`	Abhydrolase_1	58	173	4.3e-17	63.3
TkA01G516800	`PF12697`	Abhydrolase_6	60	289	5.2e-11	44.3
TkA01G516800	`PF12146`	Hydrolase_4	112	289	1.2e-05	25.4
TkA01G516800	`PF05577`	Peptidase_S28	117	159	0.015	14.9
TkA01G516800	`PF01738`	DLH	119	152	0.32	11.3
TkA01G516800	`PF07819`	PGAP1	121	156	0.093	13.2
TkA01G516800	`PF02230`	Abhydrolase_2	121	159	0.14	12.7
TkA01G516800	`PF00326`	Peptidase_S9	122	168	0.19	11.9
TkA01G516800	`PF01738`	DLH	234	297	0.32	11.3
TkA01G516800	`PF02230`	Abhydrolase_2	240	300	0.14	12.7
TkA01G516800	`PF00561`	Abhydrolase_1	242	285	4.3e-17	63.3
TkA01G516800	`PF00326`	Peptidase_S9	262	296	0.19	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card