TkA01G516320 | RubberDandelionOmics

Gene overview

TkA01G516320

Reference: TK1151 Chr: Chr01 Coordinates: 129433008-129434675 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1345 bp · TkA01G516320|TK1151|cDNA

ATTTACTCATGAATTTCAGAGAAACCCCAGCTGTAACTGCAAGAAATCGGCTCAAGTTTCAGTTGACATTCTTTTTTTAACTCAAAATTTTATTATTTGGCTCCTTTAATTAGCCTGCAATCTAGCGAGAGCAAGTTGTTGTGCTCTGTTTTTTGCTTGATTAATACTGTTTTTTTATACTGGATCCGAATTCACATGGGCGTCACGTATATAACTCTTGTTTACGTGTTGAATTTGCTTCTGAATGTTTGCCCTGGATC...

CDS

Download CDS FASTA

1026 bp · TkA01G516320|TK1151|CDS

ATGGGCGTCACGTATATAACTCTTGTTTACGTGTTGAATTTGCTTCTGAATGTTTGCCCTGGATCGTTGTCATCAATGGCGGTTCCCTCTTCCGATACGGATGCGGTTTTAATAACTGTAGATCAATCAGGACAAGGTGACTATAGAACGATACAGAAAGCCATTGATTCGGTTGCTTCTAATAACTCCGAGCTTATCTACATTTCGATCAAACCAGGAACATACAGAGAAAAAATCTCCGTTCCTGTCGATAAACCCTA...

Protein

Download Protein FASTA

341 aa · TkA01G516320|TK1151|PROTEIN

MGVTYITLVYVLNLLLNVCPGSLSSMAVPSSDTDAVLITVDQSGQGDYRTIQKAIDSVASNNSELIYISIKPGTYREKISVPVDKPYITLSGTDANTTIITWNDGGDIFDSPTVSVMASDFIARYLTIQNTFGTSGKGIALRVSADRAAFYGCRILSYQDTLLDDSGRHYYNSCYIEGATDFICGNAASLFDGCHLHSLSKSFGTITAQHRNSPLENTGFTFVGCKITGLVGGTVLGRPWGPYSRVIFAQTLMSDTVSPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G516320`
TK1151 ID	TkA01G516320
OH-1004 ID	LXL04_001718
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G516320

Location Chr01:129433008-129434675 (-)

Description Similar to PME11: Putative pectinesterase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21610`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g19730`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At5g07430`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At3g17060`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release
`At2g36710`	Acts in the modification of cell walls via demethylesterification of cell wall pectin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001718 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0042545 cell wall modification Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT2G21610

ath:AT3G17060

ath:AT5G19730

ath:AT5G47500

ath:AT5G55590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.353

Rank 1 · TkA01G516320 · TK1151

Lysosome / Vacuole0.243

Rank 2 · TkA01G516320 · TK1151

Cell membrane0.117

Rank 3 · TkA01G516320 · TK1151

Cytoplasm0.104

Rank 4 · TkA01G516320 · TK1151

Endoplasmic reticulum0.098

Rank 5 · TkA01G516320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01095Pectinesterase38-314 aa

PF00321Thionin165-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G516320	`PF01095`	Pectinesterase	38	314	1.3e-72	244.8
TkA01G516320	`PF00321`	Thionin	165	187	0.18	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIJ9`	Arabidopsis thaliana	sp\|Q9SIJ9\|PME11_ARATH Putative pectinesterase 11	61.900%	Swiss-Prot	High
`Q8VYZ3`	Arabidopsis thaliana	sp\|Q8VYZ3\|PME53_ARATH Probable pectinesterase 53	45.900%	Swiss-Prot	Medium
`Q9LY17`	Arabidopsis thaliana	sp\|Q9LY17\|PME50_ARATH Probable pectinesterase 50	38.900%	Swiss-Prot	Medium
`Q9LSP1`	Arabidopsis thaliana	sp\|Q9LSP1\|PME67_ARATH Probable pectinesterase 67	41.800%	Swiss-Prot	Medium
`Q9ZQA3`	Arabidopsis thaliana	sp\|Q9ZQA3\|PME15_ARATH Probable pectinesterase 15	41.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card