TkA01G515560 | RubberDandelionOmics

Gene overview

TkA01G515560

Reference: TK1151 Chr: Chr01 Coordinates: 129197314-129198278 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

882 bp · TkA01G515560|TK1151|cDNA

CATAAAGCCCGGCCACTACTCATTCTCCAATAACTGATCTATTCGACTCTAAATTATCATCTTAAGCTTTACGTCAACCAGCTAGCTTCAATAACGAAATGGCAGATATACGTGACGAGCATGGCCGTCCTATTCAGCTTACCGACGAGTTAGGCCGCCCGGTTCAGCTCACCGACGAGCATGGTGATCCAATCCACCTCACCGGCGTCGCTACCACTCACGGCCACCCACTATTGGATCAGAGCTTCACAACAAGATGT...

CDS

Download CDS FASTA

507 bp · TkA01G515560|TK1151|CDS

ATGTCGCATGACCAGCCAACCCACTACTCCACCATGGGGTCCGAGACTCACGGCGGAACCCACTTTGCTCCTACACCAGTCGACTACGTCAAACGTGGCGCCGATTCAGTCGCCGGTGCCGGTGCAGCCACTGTGGGTGCGGCAGCAGGAGCTGCTAAGGGGGCTGTTACCGGCGCTGCAGCACCTTTCAGCCATACCCAGGCTCACGGTGCCGGAGGTGAGAAAAAAGAGCTGCAACGATCAACAAGTTCTAGCTCCAG...

Protein

Download Protein FASTA

168 aa · TkA01G515560|TK1151|PROTEIN

MSHDQPTHYSTMGSETHGGTHFAPTPVDYVKRGADSVAGAGAATVGAAAGAAKGAVTGAAAPFSHTQAHGAGGEKKELQRSTSSSSSSSEDDGQGGRRKKKGLMQKIKEKLPGSKEKEKHATAHSADTKVSSTGGVPAGTRVEYHEQEHEKKGFMDKIKDKLPGHHSS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G515560`
TK1151 ID	TkA01G515560
OH-1004 ID	LXL04_001739
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 76.018 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G515560

Location Chr01:129197314-129198278 (-)

Description Similar to LEA: Probable dehydrin LEA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2ZDX6`	Dehydrin Rab16C.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001739 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009961 response to 1-aminocyclopropane-1-carboxylic acid Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0016151 nickel cation binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G21490

ath:AT3G50980

ath:AT5G66400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · TkA01G515560 · TK1151

Cell membrane0.316

Rank 2 · TkA01G515560 · TK1151

Nucleus0.268

Rank 3 · TkA01G515560 · TK1151

Mitochondrion0.041

Rank 4 · TkA01G515560 · TK1151

Endoplasmic reticulum0.031

Rank 5 · TkA01G515560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10439Bacteriocin_IIc18-60 aa

PF11983FtsA_C18-28 aa

PF00257Dehydrin21-166 aa

PF05642Sporozoite_P6751-114 aa

PF12336SOXp60-60 aa

PF19756DUF624370-122 aa

PF10500SR-2580-153 aa

PF12336SOXp97-143 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G515560	`PF10439`	Bacteriocin_IIc	18	60	0.17	12.6
TkA01G515560	`PF11983`	FtsA_C	18	28	0.68	11.7
TkA01G515560	`PF00257`	Dehydrin	21	166	6.5e-37	128.1
TkA01G515560	`PF05642`	Sporozoite_P67	51	114	0.36	9.6
TkA01G515560	`PF12336`	SOXp	60	60	0.32	12.7
TkA01G515560	`PF19756`	DUF6243	70	122	0.2	12.7
TkA01G515560	`PF10500`	SR-25	80	153	0.0088	16.4
TkA01G515560	`PF12336`	SOXp	97	143	0.32	12.7
TkA01G515560	`PF27439`	DnaJ_C_2	98	109	0.016	15.9
TkA01G515560	`PF11983`	FtsA_C	98	108	0.68	11.7
TkA01G515560	`PF11983`	FtsA_C	108	160	0.68	11.7
TkA01G515560	`PF10439`	Bacteriocin_IIc	121	140	0.17	12.6
TkA01G515560	`PF05642`	Sporozoite_P67	124	164	0.36	9.6
TkA01G515560	`PF27439`	DnaJ_C_2	146	160	0.016	15.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2ZDX6`	Oryza sativa subsp. indica	sp\|A2ZDX6\|DH16C_ORYSI Dehydrin Rab16C	41.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card